Mouse anti-Human RPS3 Monoclonal Antibody | anti-RPS3 antibody

RPS3 (40S Ribosomal Protein S3, FLJ26283, FLJ27450, MGC87870, OK/SW-cl.26) APC

Cat. Num. AAA6138843

• Gene Names: RPS3; S3
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RPS3; Monoclonal Antibody; RPS3 (40S Ribosomal Protein S3; FLJ26283; FLJ27450; MGC87870; OK/SW-cl.26) APC; anti-RPS3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2A8
• Specificity: Recognizes human RPS3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-RPS3 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa144-244 from human RPS3 (NP_000996) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: GQRAKSMKFVDGLMIHSGDPVNYYVDTAVRHVLLRQGVLGIKVKIMLPWDPTGKIGPKKPLPDHVSIVEPKDEILPTTPISEQKGGKPEPPAMPQPVPTA
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(RPS3 monoclonal antibody. Western Blot analysis of RPS3 expression in Hela NE.)

Testing Data

(Detection limit for recombinant GST tagged RPS3 is ~3ng/ml as a capture antibody.)

Related Product Information for anti-RPS3 antibody

RPS3 (Ribosomal protein S3) is a component of the 40S ribosomal subunit and is an an essential but previously unkown subunit of NF-kappaB involved in the regulation of key genes in rapid cellular activation responses. RPS3 interacts with nm23-H1. The expression of RPS3 reduces the secretion of MMP-9 and the invasive metastatic potential in HT1080 cells. The phosphorylated ERK is reduced by the expression of RPS3.

Product Categories/Family for anti-RPS3 antibody

Antibodies; Ribosomal Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 15718687
• NCBI GeneID: 6188
• NCBI Accession #: NP_000996
• NCBI GenBank Nucleotide #: NM_001005
• UniProt Accession #: P23396; Q498B5; Q8NI95; B2R7N5; J3KN86
• Molecular Weight: 28.8 kDa (263aa), confirmed by MALDI-TOF (Molecular weight on SDS-PAGE will appear higher)
• NCBI Official Full Name: 40S ribosomal protein S3 isoform 1
• NCBI Official Synonym Full Names: ribosomal protein S3
• NCBI Official Symbol: RPS3
• NCBI Official Synonym Symbols: S3
• NCBI Protein Information: 40S ribosomal protein S3
• UniProt Protein Name: 40S ribosomal protein S3
• Protein Family: Ribosomal protein
• UniProt Gene Name: RPS3
• UniProt Entry Name: RS3_HUMAN

NCBI Description

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit, where it forms part of the domain where translation is initiated. The protein belongs to the S3P family of ribosomal proteins. Studies of the mouse and rat proteins have demonstrated that the protein has an extraribosomal role as an endonuclease involved in the repair of UV-induced DNA damage. The protein appears to be located in both the cytoplasm and nucleus but not in the nucleolus. Higher levels of expression of this gene in colon adenocarcinomas and adenomatous polyps compared to adjacent normal colonic mucosa have been observed. This gene is co-transcribed with the small nucleolar RNA genes U15A and U15B, which are located in its first and fifth introns, respectively. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2012]

Uniprot Description

RPS3: a component of the 40S ribosomal subunit of eukaryotes. Identified in a mRNP granule complex, at least composed of ACTB, ACTN4, DHX9, ERG, HNRNPA1, HNRNPA2B1, HNRNPAB, HNRNPD, HNRNPL, HNRNPR, HNRNPU, HSPA1, HSPA8, IGF2BP1, ILF2, ILF3, NCBP1, NCL, PABPC1, PABPC4, PABPN1, RPLP0, RPS3, RPS3A, RPS4X, RPS8, RPS9, SYNCRIP, TROVE2, YBX1 and untranslated mRNAs. Identified in a HCV IRES-mediated translation complex, at least composed of EIF3C, IGF2BP1, RPS3 and HCV RNA-replicon. Localized in cytoplasmic mRNP granules containing untranslated mRNAs. Overexpressed in colorectal cancer.

Protein type: RNA-binding; Apoptosis; Translation; Ribosomal; EC 4.2.99.18

Chromosomal Location of Human Ortholog: 11q13.3-q13.5

Cellular Component: focal adhesion; membrane; cytoplasm; mitochondrial inner membrane; nucleolus; spindle; ribonucleoprotein complex; nucleus; cytosol

Molecular Function: mRNA binding; NF-kappaB binding; protein binding; DNA-(apurinic or apyrimidinic site) lyase activity; enzyme binding; structural constituent of ribosome; protein kinase A binding; oxidized purine base lesion DNA N-glycosylase activity; iron-sulfur cluster binding; damaged DNA binding; protein kinase binding

Biological Process: SRP-dependent cotranslational protein targeting to membrane; mitosis; viral reproduction; transcription, DNA-dependent; translation; apoptosis; translational termination; viral infectious cycle; DNA repair; DNA catabolic process, endonucleolytic; activation of NF-kappaB transcription factor; regulation of translation; cellular protein metabolic process; translational elongation; cell division; mRNA catabolic process, nonsense-mediated decay; translational initiation; viral transcription; gene expression; negative regulation of DNA repair; response to DNA damage stimulus