Mouse RPL4 Monoclonal Antibody | anti-RPL4 antibody

RPL4 (60S Ribosomal Protein L4, 60S Ribosomal Protein L1, RPL1, HRPL4 Ribosomal Protein L4) (PE)

Cat. Num. AAA6160038

• Gene Names: RPL4; L4
• Reactivity: Human, Mouse, Rat
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RPL4; Monoclonal Antibody; RPL4 (60S Ribosomal Protein L4; 60S Ribosomal Protein L1; RPL1; HRPL4 Ribosomal Protein L4) (PE); anti-RPL4 antibody

• Host: Mouse
• Reactivity: Human, Mouse, Rat
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4A3
• Specificity: Recognizes human RPL4. Species Crossreactivity: mouse and rat.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-RPL4 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa251-351, from human RPL4 (NP_000959) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: IWTESAFRKLDELYGTWRKAASLKSNYNLPMHKMINTDLSRILKSPEIQRALRAPRKKIHRRVLKKNPLKNLRIMLKLNPYAKTMRRNTILRQARNHKLR
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(RPL4 monoclonal antibody. Western Blot analysis of RPL4 expression in PC-12.)

Western Blot (WB)

(RPL4 monoclonal antibody. Western Blot analysis of RPL4 expression in Raw 264.7.)

Western Blot (WB)

(RPL4 monoclonal antibody, Western Blot analysis of RPL4 expression in K-562.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to RPL4 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged RPL4 is ~0.3ng/ml as a capture antibody.)

Product Categories/Family for anti-RPL4 antibody

Antibodies; Ribosomal Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 16579885
• NCBI GeneID: 6124
• NCBI Accession #: NP_000959
• NCBI GenBank Nucleotide #: NM_000968
• UniProt Accession #: P36578; P39029; Q4VBR0; Q969Z9; A8K502
• Molecular Weight: 47,697 Da
• NCBI Official Full Name: 60S ribosomal protein L4
• NCBI Official Synonym Full Names: ribosomal protein L4
• NCBI Official Symbol: RPL4
• NCBI Official Synonym Symbols: L4
• NCBI Protein Information: 60S ribosomal protein L4; 60S ribosomal protein L1
• UniProt Protein Name: 60S ribosomal protein L4
• Protein Family: 60S ribosomal protein
• UniProt Gene Name: RPL4
• UniProt Synonym Gene Names: RPL1
• UniProt Entry Name: RL4_HUMAN

Uniprot Description

RPL4: a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L4E family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq, Jul 2008]

Protein type: Translation; Ribosomal

Chromosomal Location of Human Ortholog: 15q22

Cellular Component: focal adhesion; membrane; cytoplasm; nucleolus; ribonucleoprotein complex; nucleus; cytosol

Molecular Function: protein binding; structural constituent of ribosome; RNA binding

Biological Process: SRP-dependent cotranslational protein targeting to membrane; cellular protein metabolic process; translational elongation; viral reproduction; translation; mRNA catabolic process, nonsense-mediated decay; translational initiation; gene expression; viral transcription; translational termination; viral infectious cycle