Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (RPL4 monoclonal antibody. Western Blot analysis of RPL4 expression in PC-12.)

Mouse RPL4 Monoclonal Antibody | anti-RPL4 antibody

RPL4 (60S Ribosomal Protein L4, 60S Ribosomal Protein L1, RPL1, HRPL4 Ribosomal Protein L4) (PE)

Gene Names
RPL4; L4
Reactivity
Human, Mouse, Rat
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RPL4; Monoclonal Antibody; RPL4 (60S Ribosomal Protein L4; 60S Ribosomal Protein L1; RPL1; HRPL4 Ribosomal Protein L4) (PE); anti-RPL4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4A3
Specificity
Recognizes human RPL4. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-RPL4 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa251-351, from human RPL4 (NP_000959) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
IWTESAFRKLDELYGTWRKAASLKSNYNLPMHKMINTDLSRILKSPEIQRALRAPRKKIHRRVLKKNPLKNLRIMLKLNPYAKTMRRNTILRQARNHKLR
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(RPL4 monoclonal antibody. Western Blot analysis of RPL4 expression in PC-12.)

Western Blot (WB) (RPL4 monoclonal antibody. Western Blot analysis of RPL4 expression in PC-12.)

Western Blot (WB)

(RPL4 monoclonal antibody. Western Blot analysis of RPL4 expression in Raw 264.7.)

Western Blot (WB) (RPL4 monoclonal antibody. Western Blot analysis of RPL4 expression in Raw 264.7.)

Western Blot (WB)

(RPL4 monoclonal antibody, Western Blot analysis of RPL4 expression in K-562.)

Western Blot (WB) (RPL4 monoclonal antibody, Western Blot analysis of RPL4 expression in K-562.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to RPL4 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to RPL4 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged RPL4 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged RPL4 is ~0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-RPL4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47,697 Da
NCBI Official Full Name
60S ribosomal protein L4
NCBI Official Synonym Full Names
ribosomal protein L4
NCBI Official Symbol
RPL4
NCBI Official Synonym Symbols
L4
NCBI Protein Information
60S ribosomal protein L4; 60S ribosomal protein L1
UniProt Protein Name
60S ribosomal protein L4
Protein Family
UniProt Gene Name
RPL4
UniProt Synonym Gene Names
RPL1
UniProt Entry Name
RL4_HUMAN

Uniprot Description

RPL4: a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L4E family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq, Jul 2008]

Protein type: Translation; Ribosomal

Chromosomal Location of Human Ortholog: 15q22

Cellular Component: focal adhesion; membrane; cytoplasm; nucleolus; ribonucleoprotein complex; nucleus; cytosol

Molecular Function: protein binding; structural constituent of ribosome; RNA binding

Biological Process: SRP-dependent cotranslational protein targeting to membrane; cellular protein metabolic process; translational elongation; viral reproduction; translation; mRNA catabolic process, nonsense-mediated decay; translational initiation; gene expression; viral transcription; translational termination; viral infectious cycle

Similar Products

Product Notes

The RPL4 rpl4 (Catalog #AAA6160038) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RPL4 (60S Ribosomal Protein L4, 60S Ribosomal Protein L1, RPL1, HRPL4 Ribosomal Protein L4) (PE) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RPL4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RPL4 rpl4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RPL4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.