Mouse anti-Human RPL39L Monoclonal Antibody | anti-RPL39L antibody

RPL39L (Ribosomal Protein L39-Like, 60S Ribosomal Protein L39-like, 60S Ribosomal Protein L39-2, RPL39L1) (HRP)

Cat. Num. AAA6154734

• Gene Names: RPL39L; RPL39L1
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RPL39L; Monoclonal Antibody; RPL39L (Ribosomal Protein L39-Like; 60S Ribosomal Protein L39-like; 60S Ribosomal Protein L39-2; RPL39L1) (HRP); anti-RPL39L antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 4A8-1B6
• Specificity: Recognizes human RPL39L.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-RPL39L antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 1ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-52 from human RPL39L (AAH12328) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MSSHKTFTIKRFLAKKQKQNRPIPQWIQMKPGSKIRYNSKRRHWRRTKLGL
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (31.72kD).)

Western Blot (WB)

(RPL39L monoclonal antibody, Western Blot analysis of RPL39L expression in HL-60.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to RPL39L on formalin-fixed paraffin-embedded human ovary, clear cell carcinoma tissue. [antibody concentration 1ug/ml])

Testing Data

(Detection limit for recombinant GST tagged RPL39L is ~0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-RPL39L antibody

Antibodies; Ribosomal Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 15147381
• NCBI GeneID: 116832
• Molecular Weight: 6,293 Da
• NCBI Official Full Name: Homo sapiens ribosomal protein L39-like, mRNA
• NCBI Official Synonym Full Names: ribosomal protein L39 like
• NCBI Official Symbol: RPL39L
• NCBI Official Synonym Symbols: RPL39L1
• NCBI Protein Information: 60S ribosomal protein L39-like
• Protein Family: 60S ribosomal protein

NCBI Description

This gene encodes a protein sharing high sequence similarity with ribosomal protein L39. Although the name of this gene has been referred to as 'ribosomal protein L39' in the public databases, its official name is 'ribosomal protein L39-like'. It is not currently known whether the encoded protein is a functional ribosomal protein or whether it has evolved a function that is independent of the ribosome. [provided by RefSeq, Jul 2008]