Mouse RPL32 Monoclonal Antibody | anti-RPL32 antibody

RPL32 (Ribosomal Protein L32, PP9932) (AP)

Cat. Num. AAA6163966

• Gene Names: RPL32; L32; PP9932
• Applications: ELISA
• Purity: Purified
• Synonyms: RPL32; Monoclonal Antibody; RPL32 (Ribosomal Protein L32; PP9932) (AP); Ribosomal Protein L32; PP9932; anti-RPL32 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1B11
• Specificity: Recognizes RPL32.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-RPL32 antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: RPL32 (NP_000985, 33aa-132aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: RNWRKPRGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPSGFRKFLVHNVKELEVLLMCNKSYCAEIAHNVSSKNRKAIVERAAQLAIRVTNPNARLRSE
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged RPL32 is approximately 1ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to RPL32 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to RPL32 on HeLa cell. [antibody concentration 10 ug/ml])

Related Product Information for anti-RPL32 antibody

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L32E family of ribosomal proteins. It is located in the cytoplasm. Although some studies have mapped this gene to 3q13.3-q21, it is believed to map to 3p25-p24. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Alternatively spliced transcript variants encoding the same protein have been observed for this gene. [provided by RefSeq]

Product Categories/Family for anti-RPL32 antibody

Antibodies; Ribosomal Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 4506635
• NCBI GeneID: 6161
• NCBI Accession #: NP_000985
• NCBI GenBank Nucleotide #: NM_000994
• UniProt Accession #: P62910
• Molecular Weight: 15kDa
• NCBI Official Full Name: 60S ribosomal protein L32
• NCBI Official Synonym Full Names: ribosomal protein L32
• NCBI Official Symbol: RPL32
• NCBI Official Synonym Symbols: L32; PP9932
• NCBI Protein Information: 60S ribosomal protein L32
• UniProt Protein Name: 60S ribosomal protein L32
• Protein Family: 50S ribosomal protein
• UniProt Gene Name: RPL32
• UniProt Synonym Gene Names: PP9932
• UniProt Entry Name: RL32_HUMAN

NCBI Description

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L32E family of ribosomal proteins. It is located in the cytoplasm. Although some studies have mapped this gene to 3q13.3-q21, it is believed to map to 3p25-p24. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Alternatively spliced transcript variants encoding the same protein have been observed for this gene. [provided by RefSeq, Jul 2008]