Mouse anti-Human RPL18A Monoclonal Antibody | anti-RPL18A antibody
RPL18A (60S Ribosomal Protein L18a)
Gene Names
RPL18A; RP28A
Reactivity
Human
Applications
ELISA
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
RPL18A; Monoclonal Antibody; RPL18A (60S Ribosomal Protein L18a); Anti -RPL18A (60S Ribosomal Protein L18a); anti-RPL18A antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3B7
Specificity
Recognizes human RPL18A.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
NFGIWLRYDSRSGTHNMYREYRDLTTAGAVTQCYRDMGARHRARAHSIQIMKVEEIAASKCRRPAVKQFHDSKIKFPLPHRVLRRQHKPRFTTKRPNTFF
Applicable Applications for anti-RPL18A antibody
ELISA (EL/EIA)
Application Notes
Suitable for use in ELISA.
Immunogen
Partial recombinant corresponding to aa77-177 from human RPL18A (NP_000971) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Related Product Information for anti-RPL18A antibody
Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPL18A is a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L18AE family of ribosomal proteins. It is located in the cytoplasm.
Product Categories/Family for anti-RPL18A antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
20,563 Da
NCBI Official Full Name
ribosomal 60S subunit protein L18A
NCBI Official Symbol
RPL18A
NCBI Official Synonym Symbols
RP28A
NCBI Protein Information
ribosomal 60S subunit protein L18A
UniProt Protein Name
60S ribosomal protein L18-B
Protein Family
UniProt Gene Name
RPL18B
UniProt Synonym Gene Names
RP28B
UniProt Entry Name
RL18B_YEAST
Uniprot Description
Subunit structure: Component of the large ribosomal subunit. Mature ribosomes consist of a small (40S) and a large (60S) subunit. The 40S subunit contains 32 different proteins (encoded by 56 genes) and 1 molecule of RNA (18S). The 60S subunit contains 46 different proteins (encoded by 81 genes) and 3 molecules of RNA (25S, 5.8S and 5S). Interacts with NAP1. Ref.5 Ref.10
Subcellular location: Cytoplasm Ref.7.
Miscellaneous: Present with 63700 molecules/cell in log phase SD medium.There are 2 genes for L18 in yeast.
Sequence similarities: Belongs to the ribosomal protein L18e family.
Mass spectrometry: Molecular mass is 20419.431 Da from positions 2 - 186. Determined by ESI. Monoisotopic mass. Ref.6
Similar Products
Product Notes
The RPL18A rpl18b (Catalog #AAA6008103) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RPL18A (60S Ribosomal Protein L18a) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RPL18A can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA). Suitable for use in ELISA. Researchers should empirically determine the suitability of the RPL18A rpl18b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: NFGIWLRYDS RSGTHNMYRE YRDLTTAGAV TQCYRDMGAR HRARAHSIQI MKVEEIAASK CRRPAVKQFH DSKIKFPLPH RVLRRQHKPR FTTKRPNTFF. It is sometimes possible for the material contained within the vial of "RPL18A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
