Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged RPL10L is 0.3ng/ml as a capture antibody.)

Mouse anti-Human RPL10L Monoclonal Antibody | anti-RPL10L antibody

RPL10L (60S Ribosomal Protein L10-like, FLJ27353) (HRP)

Gene Names
RPL10L; RPL10_5_1358
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RPL10L; Monoclonal Antibody; RPL10L (60S Ribosomal Protein L10-like; FLJ27353) (HRP); anti-RPL10L antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1E9
Specificity
Recognizes human RPL10L.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-RPL10L antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa115-215 from human RPL10L (NP_542784) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MRGAFGKPQGTVARVHIGQVIMSIRTKLQNEEHVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEFEDMVAKKCLIPDGCGVKYVPSHGPLDKWRVLHS
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged RPL10L is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged RPL10L is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-RPL10L antibody
This gene encodes a protein sharing sequence similarity with ribosomal protein L10. It is not currently known whether the encoded protein is a functional ribosomal protein or whether it has evolved a function that is independent of the ribosome. This gene is intronless.
Product Categories/Family for anti-RPL10L antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20 KD
NCBI Official Full Name
60S ribosomal protein L10-like
NCBI Official Synonym Full Names
ribosomal protein L10-like
NCBI Official Symbol
RPL10L
NCBI Official Synonym Symbols
RPL10_5_1358
NCBI Protein Information
60S ribosomal protein L10-like; ribosomal protein L10-like protein
UniProt Protein Name
60S ribosomal protein L10-like
Protein Family
UniProt Gene Name
RPL10L
UniProt Entry Name
RL10L_HUMAN

NCBI Description

This gene encodes a protein sharing sequence similarity with ribosomal protein L10. It is not currently known whether the encoded protein is a functional ribosomal protein or whether it has evolved a function that is independent of the ribosome. This gene is intronless. [provided by RefSeq, Jul 2008]

Uniprot Description

RPL10L: May play a role in compensating for the inactivated X- linked gene during spermatogenesis. Belongs to the ribosomal protein L10e family.

Protein type: Translation; Ribosomal

Chromosomal Location of Human Ortholog: 14q21.2

Cellular Component: polysome; membrane; nucleus

Molecular Function: structural constituent of ribosome

Biological Process: translation; spermatogenesis

Similar Products

Product Notes

The RPL10L rpl10l (Catalog #AAA6154720) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RPL10L (60S Ribosomal Protein L10-like, FLJ27353) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RPL10L can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RPL10L rpl10l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RPL10L, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.