Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human ROCK1 Monoclonal Antibody | anti-ROCK1 antibody

ROCK1 (Rho-associated Protein Kinase 1, Renal Carcinoma Antigen NY-REN-35, Rho-associated, Coiled-coil-containing Protein Kinase 1, Rho-associated, Coiled-coil-containing Protein Kinase I, ROCK-I, p160 ROCK-1, p160ROCK, MGC131603, MGC43611) (MaxLight 750)

Gene Names
ROCK1; ROCK-I; P160ROCK
Reactivity
Human
Applications
Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ROCK1; Monoclonal Antibody; ROCK1 (Rho-associated Protein Kinase 1; Renal Carcinoma Antigen NY-REN-35; Rho-associated; Coiled-coil-containing Protein Kinase 1; Coiled-coil-containing Protein Kinase I; ROCK-I; p160 ROCK-1; p160ROCK; MGC131603; MGC43611) (MaxLight 750); anti-ROCK1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2E2
Specificity
Recognizes human ROCK1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Applicable Applications for anti-ROCK1 antibody
FLISA, Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa401-511, from human ROCK1 (NP_005397) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SNRRYLSSANPNDNRTSSNADKSLQESLQKTIYKLEEQLHNEMQLKDEMEQKCRTSNIKLDKIMKELDEEGNQRRNLESTVSQIEKEKMLLQHRINEYQRKAEQENEKRR
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-ROCK1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
158,175 Da
NCBI Official Full Name
rho-associated protein kinase 1
NCBI Official Synonym Full Names
Rho-associated, coiled-coil containing protein kinase 1
NCBI Official Symbol
ROCK1
NCBI Official Synonym Symbols
ROCK-I; P160ROCK
NCBI Protein Information
rho-associated protein kinase 1; p160-ROCK; Rho kinase; p160 ROCK-1; renal carcinoma antigen NY-REN-35; rho-associated, coiled-coil-containing protein kinase 1; rho-associated, coiled-coil-containing protein kinase I
UniProt Protein Name
Rho-associated protein kinase 1
UniProt Gene Name
ROCK1
UniProt Synonym Gene Names
ROCK-I; p160ROCK
UniProt Entry Name
ROCK1_HUMAN

NCBI Description

This gene encodes a protein serine/threonine kinase that is activated when bound to the GTP-bound form of Rho. The small GTPase Rho regulates formation of focal adhesions and stress fibers of fibroblasts, as well as adhesion and aggregation of platelets and lymphocytes by shuttling between the inactive GDP-bound form and the active GTP-bound form. Rho is also essential in cytokinesis and plays a role in transcriptional activation by serum response factor. This protein, a downstream effector of Rho, phosphorylates and activates LIM kinase, which in turn, phosphorylates cofilin, inhibiting its actin-depolymerizing activity. [provided by RefSeq, Jul 2008]

Uniprot Description

ROCK1: Protein kinase which is a key regulator of actin cytoskeleton and cell polarity. Involved in regulation of smooth muscle contraction, actin cytoskeleton organization, stress fiber and focal adhesion formation, neurite retraction, cell adhesion and motility via phosphorylation of DAPK3, GFAP, LIMK1, LIMK2, MYL9/MLC2, PFN1 and PPP1R12A. Phosphorylates FHOD1 and acts synergistically with it to promote SRC-dependent non-apoptotic plasma membrane blebbing. Phosphorylates JIP3 and regulates the recruitment of JNK to JIP3 upon UVB-induced stress. Acts as a suppressor of inflammatory cell migration by regulating PTEN phosphorylation and stability. Acts as a negative regulator of VEGF-induced angiogenic endothelial cell activation. Required for centrosome positioning and centrosome-dependent exit from mitosis. Plays a role in terminal erythroid differentiation. May regulate closure of the eyelids and ventral body wall by inducing the assembly of actomyosin bundles. Promotes keratinocyte terminal differentiation. Homodimer. Interacts with RHOB, RHOC, MYLC2B snd PTEN. Interacts with RHOA (activated by GTP), CHORDC1, DAPK3, GEM, JIP3, RHOE, PPP1R12A, PFN1, LIMK1, LIMK2 and TSG101. Interacts with FHOD1 in a Src-dependent manner. Detected in blood platelets. Activated by RHOA binding. Inhibited by Y- 27632. Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family.

Protein type: Kinase, protein; Protein kinase, AGC; Protein kinase, Ser/Thr (non-receptor); EC 2.7.11.1; AGC group; DMPK family; ROCK subfamily

Chromosomal Location of Human Ortholog: 18q11.1

Cellular Component: Golgi membrane; centriole; ruffle; cytoskeleton; lamellipodium; plasma membrane; cytosol

Molecular Function: protein serine/threonine kinase activity; protein binding; metal ion binding; GTP-Rho binding; ATP binding; protein kinase activity

Biological Process: regulation of cell adhesion; axon guidance; apoptosis; bleb formation; signal transduction; protein amino acid phosphorylation; Rho protein signal transduction; negative regulation of angiogenesis; leukocyte adhesion; smooth muscle contraction; positive regulation of focal adhesion formation; regulation of stress fiber formation; regulation of actin cytoskeleton organization and biogenesis; membrane to membrane docking; myoblast migration; regulation of focal adhesion formation; ephrin receptor signaling pathway; negative regulation of neuron apoptosis; vascular endothelial growth factor receptor signaling pathway; actin cytoskeleton organization and biogenesis; leukocyte tethering or rolling; regulation of keratinocyte differentiation; leukocyte migration; cell structure disassembly during apoptosis

Research Articles on ROCK1

Similar Products

Product Notes

The ROCK1 rock1 (Catalog #AAA6235055) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ROCK1 (Rho-associated Protein Kinase 1, Renal Carcinoma Antigen NY-REN-35, Rho-associated, Coiled-coil-containing Protein Kinase 1, Rho-associated, Coiled-coil-containing Protein Kinase I, ROCK-I, p160 ROCK-1, p160ROCK, MGC131603, MGC43611) (MaxLight 750) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ROCK1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ROCK1 rock1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ROCK1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.