Mouse RNF2 Monoclonal Antibody | anti-RNF2 antibody

RNF2 (RING Finger Protein 2, BAP-1, BAP1, DING, HIPI3, Ring1B, Ring2) (AP)

Cat. Num. AAA6164441

• Gene Names: RNF2; BAP1; DING; BAP-1; HIPI3; RING2; RING1B
• Applications: Western Blot
• Purity: Purified
• Synonyms: RNF2; Monoclonal Antibody; RNF2 (RING Finger Protein 2; BAP-1; BAP1; DING; HIPI3; Ring1B; Ring2) (AP); Ring Finger Protein 2; Ring2; anti-RNF2 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2B4
• Specificity: Recognizes RNF2.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-RNF2 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: RNF2 (NP_009143, 164aa-223aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: IENGSGAEDNGDSSHCSNASTHSNQEAGPSNKRTKTSDDSGLELDNNNAAMAIDPVMDG
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(RNF2 monoclonal antibody (M14), clone 2B4. Western Blot analysis of RNF2 expression in HepG2.)

Western Blot (WB)

(RNF2 monoclonal antibody (M14), clone 2B4. Western Blot analysis of RNF2 expression in A-549.)

Testing Data

(Detection limit for recombinant GST tagged RNF2 is approximately 3ng/ml as a capture antibody.)

Western Blot (WB)

(RNF2 monoclonal antibody (M14), clone 2B4. Western Blot analysis of RNF2 expression in NIH/3T3.)

Western Blot (WB)

(RNF2 monoclonal antibody (M14), clone 2B4. Western Blot analysis of RNF2 expression in PC-12.)

Western Blot (WB)

(RNF2 monoclonal antibody (M14), clone 2B4. Western Blot analysis of RNF2 expression in Raw 264.7.)

Related Product Information for anti-RNF2 antibody

Polycomb group (PcG) of proteins form the multiprotein complexes that are important for the transcription repression of various genes involved in development and cell proliferation. The protein encoded by this gene is one of the PcG proteins. It has been shown to interact with, and suppress the activity of, transcription factor CP2 (TFCP2/CP2). Studies of the mouse counterpart suggested the involvement of this gene in the specification of anterior-posterior axis, as well as in cell proliferation in early development. This protein was also found to interact with huntingtin interacting protein 2 (HIP2), an ubiquitin-conjugating enzyme, and possess ubiquitin ligase activity. [provided by RefSeq]

Product Categories/Family for anti-RNF2 antibody

Antibodies; Transcription Factors; Zinc (Ring) Finger

NCBI and Uniprot Product Information

• NCBI GI #: 6005747
• NCBI GeneID: 6045
• NCBI Accession #: NP_009143
• NCBI GenBank Nucleotide #: NM_007212
• UniProt Accession #: Q99496; Q5TEN1; Q5TEN2; B2RBS7; B3KRH1
• Molecular Weight: 29,258 Da
• NCBI Official Full Name: E3 ubiquitin-protein ligase RING2
• NCBI Official Synonym Full Names: ring finger protein 2
• NCBI Official Symbol: RNF2
• NCBI Official Synonym Symbols: BAP1; DING; BAP-1; HIPI3; RING2; RING1B
• NCBI Protein Information: E3 ubiquitin-protein ligase RING2; HIP2-interacting protein 3; RING finger protein 1B; RING finger protein BAP-1; huntingtin-interacting protein 2-interacting protein 3; protein DinG
• UniProt Protein Name: E3 ubiquitin-protein ligase RING2
• Protein Family: E3 ubiquitin-protein ligase
• UniProt Gene Name: RNF2
• UniProt Synonym Gene Names: BAP1; DING; HIPI3; RING1B; HIP2-interacting protein 3; RING1b
• UniProt Entry Name: RING2_HUMAN