Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (IBRDC2 monoclonal antibody Western Blot analysis of IBRDC2 expression in IMR-32.)

Mouse anti-Human RNF144B Monoclonal Antibody | anti-RNF144B antibody

RNF144B (IBRDC2, P53RFP, E3 Ubiquitin-protein Ligase RNF144B, IBR Domain-containing Protein 2, RING Finger Protein 144B, p53-inducible RING Finger Protein) APC

Gene Names
RNF144B; PIR2; IBRDC2; p53RFP; bA528A10.3
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RNF144B; Monoclonal Antibody; RNF144B (IBRDC2; P53RFP; E3 Ubiquitin-protein Ligase RNF144B; IBR Domain-containing Protein 2; RING Finger Protein 144B; p53-inducible RING Finger Protein) APC; anti-RNF144B antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4F1
Specificity
Recognizes human IBRDC2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-RNF144B antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa1-101 from human IBRDC2 (NP_877434) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MGSAGRLHYLAMTAENPTPGDLAPAPLITCKLCLCEQSLDKMTTLQECQCIFCTACLKQYMQLAIREGCGSPITCPDMVCLNHGTLQEAEIACLVPVDQF
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(IBRDC2 monoclonal antibody Western Blot analysis of IBRDC2 expression in IMR-32.)

Western Blot (WB) (IBRDC2 monoclonal antibody Western Blot analysis of IBRDC2 expression in IMR-32.)

Western Blot (WB)

(Western Blot analysis of RNF144B expression in transfected 293T cell line by IBRDC2 monoclonal antibody. Lane 1: RNF144B transfected lysate (33.6kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of RNF144B expression in transfected 293T cell line by IBRDC2 monoclonal antibody. Lane 1: RNF144B transfected lysate (33.6kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to IBRDC2 on formalin-fixed paraffin-embedded human cerebellum. [antibody concentration 1.2ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to IBRDC2 on formalin-fixed paraffin-embedded human cerebellum. [antibody concentration 1.2ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to IBRDC2 on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to IBRDC2 on HeLa cell. [antibody concentration 10ug/ml])
Product Categories/Family for anti-RNF144B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase RNF144B
NCBI Official Synonym Full Names
ring finger protein 144B
NCBI Official Symbol
RNF144B
NCBI Official Synonym Symbols
PIR2; IBRDC2; p53RFP; bA528A10.3
NCBI Protein Information
E3 ubiquitin-protein ligase RNF144B
UniProt Protein Name
E3 ubiquitin-protein ligase RNF144B
UniProt Gene Name
RNF144B
UniProt Synonym Gene Names
IBRDC2; P53RFP
UniProt Entry Name
R144B_HUMAN

Uniprot Description

RNF144B: E3 ubiquitin-protein ligase which accepts ubiquitin from E2 ubiquitin-conjugating enzymes UBE2L3 and UBE2L6 in the form of a thioester and then directly transfers the ubiquitin to targeted substrates such as LCMT2, thereby promoting their degradation. Induces apoptosis via a p53/TP53-dependent but caspase-independent mechanism. However, its overexpression also produces a decrease of the ubiquitin-dependent stability of BAX, a pro-apoptotic protein, ultimately leading to protection of cell death; But, it is not an anti-apoptotic protein per se. Belongs to the RBR family. RNF144 subfamily.

Protein type: Membrane protein, integral; Ubiquitin conjugating system; Ubiquitin ligase; EC 6.3.2.-; EC 6.3.2.19; Ligase

Chromosomal Location of Human Ortholog: 6p22.3

Cellular Component: cytoplasm; mitochondrial membrane; integral to membrane; ubiquitin ligase complex

Molecular Function: protein binding; zinc ion binding; ubiquitin-protein ligase activity; ligase activity

Biological Process: apoptosis; protein ubiquitination during ubiquitin-dependent protein catabolic process

Research Articles on RNF144B

Similar Products

Product Notes

The RNF144B rnf144b (Catalog #AAA6138766) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RNF144B (IBRDC2, P53RFP, E3 Ubiquitin-protein Ligase RNF144B, IBR Domain-containing Protein 2, RING Finger Protein 144B, p53-inducible RING Finger Protein) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RNF144B can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RNF144B rnf144b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RNF144B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.