Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged RNF125 is 0.1 ng/ml as a capture antibody.)

Mouse RNF125 Monoclonal Antibody | anti-RNF125 antibody

RNF125 (RING Finger Protein 125, FLJ20456, MGC21737, TRAC1) (HRP)

Gene Names
RNF125; TNORS; TRAC1; TRAC-1
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
RNF125; Monoclonal Antibody; RNF125 (RING Finger Protein 125; FLJ20456; MGC21737; TRAC1) (HRP); Ring Finger Protein 125; TRAC1; anti-RNF125 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1D3
Specificity
Recognizes RNF125.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-RNF125 antibody
Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
RNF125 (NP_060301, 143aa-231aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
FCQRELYEDSLLDHCITHHRSERRPVFCPLCRLIPDENPSSFSGSLIRHLQVSHTLFYDDFIDFNIIEEALIRRVLDRSLLEYVNHSNT
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged RNF125 is 0.1 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged RNF125 is 0.1 ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to RNF125 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to RNF125 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to RNF125 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to RNF125 on HeLa cell. [antibody concentration 10 ug/ml])
Product Categories/Family for anti-RNF125 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase RNF125
NCBI Official Synonym Full Names
ring finger protein 125
NCBI Official Symbol
RNF125
NCBI Official Synonym Symbols
TNORS; TRAC1; TRAC-1
NCBI Protein Information
E3 ubiquitin-protein ligase RNF125
UniProt Protein Name
E3 ubiquitin-protein ligase RNF125
UniProt Gene Name
RNF125
UniProt Synonym Gene Names
TRAC-1
UniProt Entry Name
RN125_HUMAN

NCBI Description

This gene encodes a novel E3 ubiquitin ligase that contains a RING finger domain in the N-terminus and three zinc-binding and one ubiquitin-interacting motif in the C-terminus. As a result of myristoylation, this protein associates with membranes and is primarily localized to intracellular membrane systems. The encoded protein may function as a positive regulator in the T-cell receptor signaling pathway. [provided by RefSeq, Mar 2012]

Uniprot Description

RNF125: E3 ubiquitin-protein ligase that acts as a positive regulator of T-cell activation. E3 ligase proteins mediate ubiquitination and subsequent proteasomal degradation of target proteins.

Protein type: Ubiquitin conjugating system; Ubiquitin ligase; EC 6.3.2.19; EC 6.3.2.-; Ligase

Chromosomal Location of Human Ortholog: 18q12.1

Molecular Function: zinc ion binding; ubiquitin-protein ligase activity; ligase activity

Biological Process: protein ubiquitination; innate immune response; negative regulation of interferon type I production

Disease: Tenorio Syndrome

Research Articles on RNF125

Similar Products

Product Notes

The RNF125 rnf125 (Catalog #AAA6181586) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's RNF125 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RNF125 rnf125 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RNF125, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.