Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of RIPK2 expression in HeLa cells using.)

Mouse RIPK2 Monoclonal Antibody | anti-RIPK2 antibody

RIPK2 (Receptor-Interacting Serine-Threonine Kinase 2, CARD3, CARDIAK, CCK, GIG30, RICK, RIP2) (FITC)

Gene Names
RIPK2; CCK; RICK; RIP2; CARD3; GIG30; CARDIAK
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Purified
Synonyms
RIPK2; Monoclonal Antibody; RIPK2 (Receptor-Interacting Serine-Threonine Kinase 2; CARD3; CARDIAK; CCK; GIG30; RICK; RIP2) (FITC); Receptor-Interacting Serine-Threonine Kinase 2; RIP2; anti-RIPK2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3D9
Specificity
Recognizes human RIPK2. Species Crossreactivity: mouse and rat
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
540
Applicable Applications for anti-RIPK2 antibody
FLISA, Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa431-540 from human RIPK2 with GST tag. MW of the GST tag alone is 26kD. GeneBank: AAH04553
Immunogen Sequence
LQPGIAQQWIQSKREDIVNQMTEACLNQSLDALLSRDLIMKEDYELVSTKPTRTSKVRQLLDTTDIQGEEFAKVIVQKLKDNKQMGLQPYPEILVVSRSPSLNLLQNKSM
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of RIPK2 expression in HeLa cells using.)

Western Blot (WB) (Western Blot analysis of RIPK2 expression in HeLa cells using.)

Testing Data

(Detection limit for is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for is ~0.1ng/ml as a capture antibody.)

Immunohistochemistry (IHC)

(Immunoperoxidase on formalin-fixed paraffin-embedded human prostate using (1.2ug/ml).)

Immunohistochemistry (IHC) (Immunoperoxidase on formalin-fixed paraffin-embedded human prostate using (1.2ug/ml).)

Testing Data

Testing Data
Related Product Information for anti-RIPK2 antibody
This gene encodes a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases. The encoded protein contains a C-terminal caspase activation and recruitment domain (CARD), and is a component of signaling complexes in both the innate and adaptive immune pathways. It is a potent activator of NF-kappaB and inducer of apoptosis in response to various stimuli. [provided by RefSeq]
Product Categories/Family for anti-RIPK2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Receptor-interacting serine-threonine kinase 2
NCBI Official Synonym Full Names
receptor interacting serine/threonine kinase 2
NCBI Official Symbol
RIPK2
NCBI Official Synonym Symbols
CCK; RICK; RIP2; CARD3; GIG30; CARDIAK
NCBI Protein Information
receptor-interacting serine/threonine-protein kinase 2

NCBI Description

This gene encodes a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases. The encoded protein contains a C-terminal caspase activation and recruitment domain (CARD), and is a component of signaling complexes in both the innate and adaptive immune pathways. It is a potent activator of NF-kappaB and inducer of apoptosis in response to various stimuli. [provided by RefSeq, Jul 2008]

Research Articles on RIPK2

Similar Products

Product Notes

The RIPK2 (Catalog #AAA6175578) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RIPK2 (Receptor-Interacting Serine-Threonine Kinase 2, CARD3, CARDIAK, CCK, GIG30, RICK, RIP2) (FITC) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RIPK2 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunohistochemistry (IHC), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RIPK2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RIPK2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.