Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (RING1 monoclonal antibody (M10), clone 1F4. Western Blot analysis of RING1 expression in Hela S3 NE (Cat # L013V3).)

Mouse RING1 Monoclonal Antibody | anti-RING1 antibody

RING1 (RING Finger Protein 1, Ring1A, RNF1) (Biotin)

Gene Names
RING1; RNF1; RING1A
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
RING1; Monoclonal Antibody; RING1 (RING Finger Protein 1; Ring1A; RNF1) (Biotin); Ring Finger Protein 1; RNF1; anti-RING1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1F4
Specificity
Recognizes RING1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-RING1 antibody
Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
RING1 (NP_002922, 81aa-170aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
NKECPTCRKKLVSKRSLRPDPNFDALISKIYPSREEYEAHQDRVLIRLSRLHNQQALSSSIEEGLRMQAMHRAQRVRRPIPGSDQTTTMS
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(RING1 monoclonal antibody (M10), clone 1F4. Western Blot analysis of RING1 expression in Hela S3 NE (Cat # L013V3).)

Western Blot (WB) (RING1 monoclonal antibody (M10), clone 1F4. Western Blot analysis of RING1 expression in Hela S3 NE (Cat # L013V3).)

Testing Data

(Detection limit for recombinant GST tagged RING1 is 3 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged RING1 is 3 ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to RING1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to RING1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to RING1 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to RING1 on HeLa cell. [antibody concentration 10 ug/ml])
Related Product Information for anti-RING1 antibody
This gene belongs to the RING finger family, members of which encode proteins characterized by a RING domain, a zinc-binding motif related to the zinc finger domain. The gene product can bind DNA and can act as a transcriptional repressor. It is associated with the multimeric polycomb group protein complex. The gene product interacts with the polycomb group proteins BMI1, EDR1, and CBX4, and colocalizes with these proteins in large nuclear domains. It interacts with the CBX4 protein via its glycine-rich C-terminal domain. The gene maps to the HLA class II region, where it is contiguous with the RING finger genes FABGL and HKE4. [provided by RefSeq]
Product Categories/Family for anti-RING1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39,146 Da
NCBI Official Full Name
E3 ubiquitin-protein ligase RING1
NCBI Official Synonym Full Names
ring finger protein 1
NCBI Official Symbol
RING1
NCBI Official Synonym Symbols
RNF1; RING1A
NCBI Protein Information
E3 ubiquitin-protein ligase RING1; polycomb complex protein RING1; really interesting new gene 1 protein
UniProt Protein Name
E3 ubiquitin-protein ligase RING1
UniProt Gene Name
RING1
UniProt Synonym Gene Names
RNF1
UniProt Entry Name
RING1_HUMAN

Uniprot Description

RING1: Constitutes one of the E3 ubiquitin-protein ligases that mediate monoubiquitination of 'Lys-119' of histone H2A, thereby playing a central role in histone code and gene regulation. H2A 'Lys-119' ubiquitination gives a specific tag for epigenetic transcriptional repression and participates in X chromosome inactivation of female mammals. Essential component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones, rendering chromatin heritably changed in its expressibility. Compared to RNF2/RING2, it does not have the main E3 ubiquitin ligase activity on histone H2A, and it may rather act as a modulator of RNF2/RING2 activity. Component of chromatin-associated Polycomb (PcG) complexes. Interacts with BMI1. Part of the E2F6.com-1 complex in G0 phase composed of E2F6, MGA, MAX, TFDP1, CBX3, BAT8, EUHMTASE1, RING1, RNF2/RING2 MBLR, L3MBTL2 and YAF2. Interacts with CBX2 and PCGF6. Component of a PRC1-like complex. Component of repressive BCOR complex containing Polycomb group subcomplex at least composed of RYBP, PCGF1, BCOR and RNF2/RING2. Interacts with PCGF2, RNF2; CBX6, CBX7 and CBX8. Interacts with PHC2. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Ligase; Transcription factor; EC 6.3.2.-; EC 6.3.2.19; Ubiquitin conjugating system; Ubiquitin ligase

Chromosomal Location of Human Ortholog: 6p21.3

Cellular Component: nucleoplasm; sex chromatin; cytoplasm; nuclear speck; PcG protein complex; nucleus

Molecular Function: protein binding; zinc ion binding; ubiquitin-protein ligase activity; chromatin binding; ligase activity

Biological Process: anterior/posterior pattern formation; camera-type eye morphogenesis; transcription, DNA-dependent; negative regulation of transcription, DNA-dependent

Similar Products

Product Notes

The RING1 ring1 (Catalog #AAA6172994) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's RING1 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RING1 ring1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RING1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.