Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (RNF2 monoclonal antibody. Western Blot analysis of RNF2 expression in Raw 264.7.)

Mouse anti-Human, Mouse RING Finger Protein 2 Monoclonal Antibody | anti-RNF2 antibody

RING Finger Protein 2 (RNF2, BAP1, BAP-1, DING, E3 Ubiquitin Protein Ligase RING2, Huntingtin-interacting Protein 2-interacting Protein 3, HIP2-interacting Protein 3, HIPI3, Protein DinG, RING Finger Protein 1b, RING1B, RING Finger Protein BAP-1, RING2) (

Gene Names
RNF2; BAP1; DING; BAP-1; HIPI3; RING2; RING1B
Reactivity
Human, Mouse
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RING Finger Protein 2; Monoclonal Antibody; RING Finger Protein 2 (RNF2; BAP1; BAP-1; DING; E3 Ubiquitin Protein Ligase RING2; Huntingtin-interacting Protein 2-interacting Protein 3; HIP2-interacting Protein 3; HIPI3; Protein DinG; RING Finger Protein 1b; RING1B; RING Finger Protein BAP-1; RING2) (; anti-RNF2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6C2
Specificity
Recognizes human RNF2. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-RNF2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa192-291, from human RNF2 (NP_009143) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PSNKRTKTSDDSGLELDNNNAAMAIDPVMDGASEIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELRSKGESNQMNLDTASEKQ
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(RNF2 monoclonal antibody. Western Blot analysis of RNF2 expression in Raw 264.7.)

Western Blot (WB) (RNF2 monoclonal antibody. Western Blot analysis of RNF2 expression in Raw 264.7.)

Western Blot (WB)

(RNF2 monoclonal antibody, Western Blot analysis of RNF2 expression in NIH/3T3.)

Western Blot (WB) (RNF2 monoclonal antibody, Western Blot analysis of RNF2 expression in NIH/3T3.)

Western Blot (WB)

(Western Blot analysis of RNF2 expression in transfected 293T cell line by RNF2 monoclonal antibody. Lane 1: RNF2 transfected lysate (37.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of RNF2 expression in transfected 293T cell line by RNF2 monoclonal antibody. Lane 1: RNF2 transfected lysate (37.7kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged RNF2 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged RNF2 is ~0.03ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of RNF2 over-expressed 293 cell line, cotransfected with RNF2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with RNF2 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of RNF2 over-expressed 293 cell line, cotransfected with RNF2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with RNF2 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)
Related Product Information for anti-RNF2 antibody
Polycomb group (PcG) of proteins form the multiprotein complexes that are important for the transcription repression of various genes involved in development and cell proliferation. The protein encoded by this gene is one of the PcG proteins. It has been shown to interact with, and suppress the activity of, transcription factor CP2 (TFCP2/CP2). Studies of the mouse counterpart suggested the involvement of this gene in the specification of anterior-posterior axis, as well as in cell proliferation in early development. This protein was also found to interact with huntingtin interacting protein 2 (HIP2), an ubiquitin-conjugating enzyme, and possess ubiquitin ligase activity. [provided by RefSeq]
Product Categories/Family for anti-RNF2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29,258 Da
NCBI Official Full Name
E3 ubiquitin-protein ligase RING2
NCBI Official Synonym Full Names
ring finger protein 2
NCBI Official Symbol
RNF2
NCBI Official Synonym Symbols
BAP1; DING; BAP-1; HIPI3; RING2; RING1B
NCBI Protein Information
E3 ubiquitin-protein ligase RING2; HIP2-interacting protein 3; RING finger protein 1B; RING finger protein BAP-1; huntingtin-interacting protein 2-interacting protein 3; protein DinG
UniProt Protein Name
E3 ubiquitin-protein ligase RING2
Protein Family
UniProt Gene Name
RNF2
UniProt Synonym Gene Names
BAP1; DING; HIPI3; RING1B; HIP2-interacting protein 3; RING1b
UniProt Entry Name
RING2_HUMAN

Similar Products

Product Notes

The RNF2 rnf2 (Catalog #AAA6144036) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RING Finger Protein 2 (RNF2, BAP1, BAP-1, DING, E3 Ubiquitin Protein Ligase RING2, Huntingtin-interacting Protein 2-interacting Protein 3, HIP2-interacting Protein 3, HIPI3, Protein DinG, RING Finger Protein 1b, RING1B, RING Finger Protein BAP-1, RING2) ( reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's RING Finger Protein 2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RNF2 rnf2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RING Finger Protein 2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.