Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (33.15kD).)

Mouse anti-Human RING Finger Protein 181 Monoclonal Antibody | anti-RNF181 antibody

RING Finger Protein 181 (RNF181, E3 Ubiquitin-protein Ligase RNF181, HSPC238) (AP)

Gene Names
RNF181; HSPC238
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RING Finger Protein 181; Monoclonal Antibody; RING Finger Protein 181 (RNF181; E3 Ubiquitin-protein Ligase RNF181; HSPC238) (AP); EC=6.3.2.-; anti-RNF181 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
5A7
Specificity
Recognizes human RNF181.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-RNF181 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa90-154 from human RNF181 (NP_057578) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
IEMPCHHLFHSSCILPWLSKTNSCPLCRYELPTDDDTYEEHRRDKARKQQQQHRLENLHGAMYT
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (33.15kD).)

Western Blot (WB) (Western Blot detection against Immunogen (33.15kD).)

Western Blot (WB)

(RNF181 monoclonal antibody, Western Blot analysis of RNF181 expression in Jurkat.)

Western Blot (WB) (RNF181 monoclonal antibody, Western Blot analysis of RNF181 expression in Jurkat.)

Western Blot (WB)

(Western Blot analysis of RNF181 expression in transfected 293T cell line by RNF181 monoclonal antibody. Lane 1: RNF181 transfected lysate (17.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of RNF181 expression in transfected 293T cell line by RNF181 monoclonal antibody. Lane 1: RNF181 transfected lysate (17.9kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of RNF181 transfected lysate using RNF181 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with RNF181 monoclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of RNF181 transfected lysate using RNF181 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with RNF181 monoclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged RNF181 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged RNF181 is ~0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-RNF181 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20.3 kDa (176aa) confirmed by MALDI-TOF
NCBI Official Full Name
E3 ubiquitin-protein ligase RNF181
NCBI Official Synonym Full Names
ring finger protein 181
NCBI Official Symbol
RNF181
NCBI Official Synonym Symbols
HSPC238
NCBI Protein Information
E3 ubiquitin-protein ligase RNF181
UniProt Protein Name
E3 ubiquitin-protein ligase RNF181
UniProt Gene Name
RNF181
UniProt Entry Name
RN181_HUMAN

NCBI Description

RNF181 binds the integrin alpha-IIb (ITGA2B; MIM 607759)/beta-3 (ITGB3; MIM 173470) complex and has E3 ubiquitin ligase activity (Brophy et al., 2008 [PubMed 18331836]).[supplied by OMIM, Dec 2008]

Uniprot Description

RNF181: E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Belongs to the RNF181 family.

Protein type: Ligase; Ubiquitin ligase; EC 6.3.2.-; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 2p11.2

Molecular Function: zinc ion binding; ubiquitin-protein ligase activity; ligase activity

Biological Process: protein autoubiquitination

Research Articles on RNF181

Similar Products

Product Notes

The RNF181 rnf181 (Catalog #AAA6133473) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RING Finger Protein 181 (RNF181, E3 Ubiquitin-protein Ligase RNF181, HSPC238) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RING Finger Protein 181 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RNF181 rnf181 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RING Finger Protein 181, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.