Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human RING Finger Protein 113B Monoclonal Antibody | anti-RNF113B antibody

RING Finger Protein 113B (RNF113B, bA10G5.1, RNF161, Zinc Finger Protein 183-like 1, ZNF183L1) (PE)

Gene Names
RNF113B; RNF161; ZNF183L1; bA10G5.1
Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RING Finger Protein 113B; Monoclonal Antibody; RING Finger Protein 113B (RNF113B; bA10G5.1; RNF161; Zinc Finger Protein 183-like 1; ZNF183L1) (PE); MGC26599; anti-RNF113B antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2B11
Specificity
Recognizes human RNF113B.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-RNF113B antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa1-101 from human RNF113B (NP_849192) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAAPPSPGRTADQADQVCTFLFKKPGRKGAAGLRKRPACDPEHGESSSSGDEGDTVAQPPRVAPRPRGLHSWQKAAHGDRRGEEAAPESLDVVYRSTRSA
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Immunoprecipitation (IP)

(Immunoprecipitation of RNF113B transfected lysate using RNF113B monoclonal antibody and Protein A Magnetic Bead and immunoblotted with RNF113B rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of RNF113B transfected lysate using RNF113B monoclonal antibody and Protein A Magnetic Bead and immunoblotted with RNF113B rabbit polyclonal antibody.)
Product Categories/Family for anti-RNF113B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36,259 Da
NCBI Official Full Name
RING finger protein 113B
NCBI Official Synonym Full Names
ring finger protein 113B
NCBI Official Symbol
RNF113B
NCBI Official Synonym Symbols
RNF161; ZNF183L1; bA10G5.1
NCBI Protein Information
RING finger protein 113B
UniProt Protein Name
RING finger protein 113B
Protein Family
UniProt Gene Name
RNF113B
UniProt Synonym Gene Names
RNF161; ZNF183L1
UniProt Entry Name
R113B_HUMAN

Uniprot Description

RNF113B:

Protein type: Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 13q32.2

Molecular Function: zinc ion binding

Similar Products

Product Notes

The RNF113B rnf113b (Catalog #AAA6159967) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RING Finger Protein 113B (RNF113B, bA10G5.1, RNF161, Zinc Finger Protein 183-like 1, ZNF183L1) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RING Finger Protein 113B can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RNF113B rnf113b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RING Finger Protein 113B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.