Mouse anti-Human RHOJ Monoclonal Antibody | anti-RHOJ antibody

RHOJ (ARHJ, Rho-related GTP-binding Protein RhoJ, Ras-like Protein Family Member 7B, RASL7B, RHOI, Tc10-like GTP-binding Protein, TCL, TC10B)

Cat. Num. AAA6007098

• Gene Names: RHOJ; TCL; ARHJ; TC10B; RASL7B
• Reactivity: Human
• Applications: ELISA, Western Blot, Immunofluorescence
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: RHOJ; Monoclonal Antibody; RHOJ (ARHJ; Rho-related GTP-binding Protein RhoJ; Ras-like Protein Family Member 7B; RASL7B; RHOI; Tc10-like GTP-binding Protein; TCL; TC10B); Anti -RHOJ (ARHJ; anti-RHOJ antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1 lambda
• Clone Number: 1E4
• Specificity: Recognizes human RHOJ.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MNCKEGTDSSCGCRGNDEKKMLKCVVVGDGAVGKTCLLMSYANDAFPEEYVPTVFDHYAVTVTVGGKQHLLGLYDTAGQEDYNQLRPLSYPNTDVFLICFSVVNPASYHNVQEEWVPELKDCMPHVPYVLIGTQIDLRDDPKTLARLLYMKEKPLTYEHGVKLAKAIGAQCYLECSALTQKGLKAVFDEAILTIFHPKKKKKRCSEGHSCCSII

• Applicable Applications for anti-RHOJ antibody: ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF)
• Application Notes: Suitable for use in Immunofluorescence, ELISA and Western Blot.; Dilution: Immunofluorescence: 60ug/ml
• Immunogen: Full length recombinant corresponding to aa1-215 from human RHOJ (AAH62575) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (49.65kD).)

Western Blot (WB)

(RHOJ monoclonal antibody, Western Blot analysis of RHOJ expression in HepG2.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to RHOJ on HeLa cell. [antibody concentration 60ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged RHOJ is ~1ng/ml as a capture antibody.)

Product Categories/Family for anti-RHOJ antibody

Antibodies; Abs to GTPase; Rab; Ras; Rho Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 16903164
• NCBI GeneID: 57381
• NCBI Accession #: NP_065714.1
• NCBI GenBank Nucleotide #: NM_020663.4
• UniProt Accession #: Q9H4E5; Q96KC1
• Molecular Weight: 23,821 Da
• NCBI Official Full Name: rho-related GTP-binding protein RhoJ
• NCBI Official Synonym Full Names: ras homolog family member J
• NCBI Official Symbol: RHOJ
• NCBI Official Synonym Symbols: TCL; ARHJ; TC10B; RASL7B
• NCBI Protein Information: rho-related GTP-binding protein RhoJ; TC10-like Rho GTPase; RAS-like, family 7, member B; tc10-like GTP-binding protein; ras homolog gene family, member J; ras-like protein family member 7B
• UniProt Protein Name: Rho-related GTP-binding protein RhoJ
• Protein Family: Rho-related GTP-binding protein
• UniProt Gene Name: RHOJ
• UniProt Synonym Gene Names: ARHJ; RASL7B; RHOI; TCL
• UniProt Entry Name: RHOJ_HUMAN

NCBI Description

This gene encodes one of the many small GTP-binding proteins in the Rho family shown to be associated with focal adhesions in endothelial cells (PMID: 21148427, 22103495). The encoded protein is activated by vascular endothelial growth factor and may regulate angiogenesis. [provided by RefSeq, Dec 2011]

Uniprot Description

RHOJ: GTP-binding protein with GTPase activity. Elicits the formation of F-actin-rich structures in fibroblasts and is involved in the regulation of cell morphology. Belongs to the small GTPase superfamily. Rho family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: G protein, monomeric, Rho; G protein; Motility/polarity/chemotaxis; G protein, monomeric

Chromosomal Location of Human Ortholog: 14q23.2

Cellular Component: plasma membrane; cytosol

Molecular Function: GTPase activity; GTP binding

Biological Process: regulation of cell shape; regulation of small GTPase mediated signal transduction; metabolic process; small GTPase mediated signal transduction; actin cytoskeleton organization and biogenesis; Rho protein signal transduction