Mouse anti-Human RHOA Monoclonal Antibody | anti-RHOA antibody

RHOA (ARH12, ARHA, RHO12, RHOH12, Aplysia ras-related Homolog 12, Oncogene RHO H12, Small GTP Binding Protein RhoA) (MaxLight 490)

Cat. Num. AAA6204944

• Gene Names: RHOA; ARHA; ARH12; RHO12; EDFAOB; RHOH12
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified
• Synonyms: RHOA; Monoclonal Antibody; RHOA (ARH12; ARHA; RHO12; RHOH12; Aplysia ras-related Homolog 12; Oncogene RHO H12; Small GTP Binding Protein RhoA) (MaxLight 490); anti-RHOA antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1, lambda
• Clone Number: 1C11
• Specificity: Recognizes human RHOA.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
• Sequence Length: 193

• Applicable Applications for anti-RHOA antibody: FLISA, Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Recombinant protein corresponding to aa1-193 from full-length human RHOA with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL
• Conjugate: MaxLight490
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Related Product Information for anti-RHOA antibody

Regulates a signal transduction pathway linking plasma membrane receptors to the assembly of focal adhesions and actin stress fibers. Involved in a microtubule-dependent signal that is required for the myosin contractile ring formation during cell cycle cytokinesis. Plays an essential role in cleavage furrow formation. Required for the apical junction formation of keratinocyte cell-cell adhesion. Serves as a target for the yopT cysteine peptidase from Yersinia pestis, vector of the plague, and Yersinia pseudotuberculosis, which causes gastrointestinal disorders. Stimulates PKN2 kinase activity. May be an activator of PLCE1. Activated by ARHGEF2, which promotes the exchange of GDP for GTP. Essential for the SPATA13-mediated regulation of cell migration and adhesion assembly and disassembly. The MEMO1-RHOA-DIAPH1 signaling pathway plays an important role in ERBB2-dependent stabilization of microtubules at the cell cortex. It controls the localization of APC and CLASP2 to the cell membrane, via the regulation of GSK3B activity. In turn, membrane-bound APC allows the localization of the MACF1 to the cell membrane, which is required for microtubule capture and stabilization.

Product Categories/Family for anti-RHOA antibody

Antibodies; GTPase; Rab; Ras; Rho Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 12655025
• NCBI GeneID: 387
• NCBI Official Full Name: Ras homolog gene family, member A
• NCBI Official Synonym Full Names: ras homolog family member A
• NCBI Official Symbol: RHOA
• NCBI Official Synonym Symbols: ARHA; ARH12; RHO12; EDFAOB; RHOH12
• NCBI Protein Information: transforming protein RhoA
• Protein Family: GTP-binding protein

NCBI Description

This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants have been identified. [provided by RefSeq, Sep 2015]