Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (32.93kD).)

Mouse anti-Human, Rat RHCG Monoclonal Antibody | anti-RHCG antibody

RHCG (Rhesus Blood Group Family Type C Glycoprotein, Rh Family Type C Glycoprotein, Rh Type C Glycoprotein, Ammonium Transporter Rh Type C, C15orf6, CDRC2, PDRC2, Rh Glycoprotein Kidney, RHGK, SLC42A3, Tumor-related Protein DRC2) (HRP)

Gene Names
RHCG; RHGK; PDRC2; C15orf6; SLC42A3
Reactivity
Human, Rat
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RHCG; Monoclonal Antibody; RHCG (Rhesus Blood Group Family Type C Glycoprotein; Rh Family Type C Glycoprotein; Rh Type C Glycoprotein; Ammonium Transporter Rh Type C; C15orf6; CDRC2; PDRC2; Rh Glycoprotein Kidney; RHGK; SLC42A3; Tumor-related Protein DRC2) (HRP); anti-RHCG antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
5A4
Specificity
Recognizes human RHCG. Species Crossreactivity: rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-RHCG antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa418-480 from human RHCG (NP_057405) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LPFWGQPSDENCFEDAVYWEMPEGNSTVYIPEDPTFKPSGPSVPSVPMVSPLPMASSVPLVP
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (32.93kD).)

Western Blot (WB) (Western Blot detection against Immunogen (32.93kD).)

Western Blot (WB)

(RHCG monoclonal antibody, Western Blot analysis of RHCG expression in PC-12.)

Western Blot (WB) (RHCG monoclonal antibody, Western Blot analysis of RHCG expression in PC-12.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to RHCG on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to RHCG on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3ug/ml].)
Product Categories/Family for anti-RHCG antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53 kDa
NCBI Official Full Name
ammonium transporter Rh type C
NCBI Official Synonym Full Names
Rh family C glycoprotein
NCBI Official Symbol
RHCG
NCBI Official Synonym Symbols
RHGK; PDRC2; C15orf6; SLC42A3
NCBI Protein Information
ammonium transporter Rh type C
UniProt Protein Name
Ammonium transporter Rh type C
Protein Family
UniProt Gene Name
RHCG
UniProt Synonym Gene Names
C15orf6; CDRC2; PDRC2; RHGK; Rh family type C glycoprotein; Rh type C glycoprotein
UniProt Entry Name
RHCG_HUMAN

Uniprot Description

RHCG: Functions as an electroneutral and bidirectional ammonium transporter. May regulate transepithelial ammonia secretion. Belongs to the ammonium transporter (TC 2.A.49) family. Rh subfamily.

Protein type: Transporter, SLC family; Transporter; Membrane protein, multi-pass; Vesicle; Membrane protein, integral

Chromosomal Location of Human Ortholog: 15q25

Cellular Component: integral to plasma membrane; basolateral plasma membrane; apical plasma membrane; plasma membrane; cytoplasmic vesicle

Molecular Function: ammonium transmembrane transporter activity; ankyrin binding

Biological Process: homeostatic process; epithelial cell differentiation; cellular ion homeostasis; amine transport; regulation of pH; transmembrane transport; ammonium transport

Research Articles on RHCG

Similar Products

Product Notes

The RHCG rhcg (Catalog #AAA6154627) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RHCG (Rhesus Blood Group Family Type C Glycoprotein, Rh Family Type C Glycoprotein, Rh Type C Glycoprotein, Ammonium Transporter Rh Type C, C15orf6, CDRC2, PDRC2, Rh Glycoprotein Kidney, RHGK, SLC42A3, Tumor-related Protein DRC2) (HRP) reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RHCG can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RHCG rhcg for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RHCG, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.