Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.89kD).)

Mouse anti-Human RFFL Monoclonal Antibody | anti-RFFL antibody

RFFL (RING Finger and FYVE-like Domain-containing Protein 1, E3 Ubiquitin-protein Ligase Rififylin, Caspase Regulator CARP2, Caspases-8 and -10-associated RING Finger Protein 2, CARP2, CARP-2, FYVE-RING Finger Protein Sakura, Fring, RING Finger Protein 18

Gene Names
RFFL; CARP2; FRING; CARP-2; RNF189; RNF34L; RIFIFYLIN
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RFFL; Monoclonal Antibody; RFFL (RING Finger and FYVE-like Domain-containing Protein 1; E3 Ubiquitin-protein Ligase Rififylin; Caspase Regulator CARP2; Caspases-8 and -10-associated RING Finger Protein 2; CARP2; CARP-2; FYVE-RING Finger Protein Sakura; Fring; RING Finger Protein 18; EC=6.3.2.-; anti-RFFL antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3A4
Specificity
Recognizes human RFFL.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-RFFL antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa2-100 from human RFFL (NP_001017368) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
WATCCNWFCLDGQPEEVPPPQGARMQAYSNPGYSSFPSPTGLEPSCKSCGAHFANTARKQTCLDCKKNFCMTCSSQVGNGPRLCLLCQRFRATAFQRE
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.89kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.89kD).)

Western Blot (WB)

(Western Blot analysis of RFFL expression in transfected 293T cell line by RFFL monoclonal antibody. Lane 1: RFFL transfected lysate (36.6kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of RFFL expression in transfected 293T cell line by RFFL monoclonal antibody. Lane 1: RFFL transfected lysate (36.6kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged RFFL is 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged RFFL is 0.03ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of RFFL over-expressed 293 cell line, cotransfected with RFFL Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with RFFL monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of RFFL over-expressed 293 cell line, cotransfected with RFFL Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with RFFL monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)
Product Categories/Family for anti-RFFL antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase rififylin
NCBI Official Synonym Full Names
ring finger and FYVE like domain containing E3 ubiquitin protein ligase
NCBI Official Symbol
RFFL
NCBI Official Synonym Symbols
CARP2; FRING; CARP-2; RNF189; RNF34L; RIFIFYLIN
NCBI Protein Information
E3 ubiquitin-protein ligase rififylin
UniProt Protein Name
E3 ubiquitin-protein ligase rififylin
UniProt Gene Name
RFFL
UniProt Synonym Gene Names
CARP-2; Fring
UniProt Entry Name
RFFL_HUMAN

Uniprot Description

RFFL: Has E3 ubiquitin protein ligase activity. Regulates the levels of CASP8 and CASP10 by targeting them for proteasomal degradation. Has anti-apoptotic activity. May bind phosphatidylinositol phosphates. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Ligase; EC 6.3.2.-; Vesicle; Ubiquitin conjugating system; Ubiquitin ligase

Chromosomal Location of Human Ortholog: 17q12

Cellular Component: Golgi membrane; membrane; recycling endosome membrane; lysosome; cytoplasm; cytoplasmic membrane-bound vesicle; plasma membrane; endosome membrane; cytosol

Molecular Function: protein binding; protease binding; zinc ion binding; p53 binding; ubiquitin protein ligase binding; protein kinase binding; ligase activity

Biological Process: ubiquitin-dependent protein catabolic process; intracellular protein transport; proteasomal ubiquitin-dependent protein catabolic process; protein ubiquitination during ubiquitin-dependent protein catabolic process; regulation of TOR signaling pathway

Research Articles on RFFL

Similar Products

Product Notes

The RFFL rffl (Catalog #AAA6144000) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RFFL (RING Finger and FYVE-like Domain-containing Protein 1, E3 Ubiquitin-protein Ligase Rififylin, Caspase Regulator CARP2, Caspases-8 and -10-associated RING Finger Protein 2, CARP2, CARP-2, FYVE-RING Finger Protein Sakura, Fring, RING Finger Protein 18 reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RFFL can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RFFL rffl for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RFFL, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.