Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD))

Mouse anti-Human REXO2 Monoclonal Antibody | anti-REXO2 antibody

REXO2 (RNA Exonuclease 2 Homolog, REX2, CGI-114, Oligoribonuclease, Mitochondrial, RFN, Small Fragment Nuclease , SFN, SMFN)

Gene Names
REXO2; RFN; SFN; REX2; CGI-114
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
REXO2; Monoclonal Antibody; REXO2 (RNA Exonuclease 2 Homolog; REX2; CGI-114; Oligoribonuclease; Mitochondrial; RFN; Small Fragment Nuclease; SFN; SMFN); Anti -REXO2 (RNA Exonuclease 2 Homolog; anti-REXO2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2B5
Specificity
Recognizes human REXO2.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
HGRSGLTKAVKESTITLQQAEYEFLSFVRQQTPPGLCPLAGNSVHEDKKFLDKYMPQFMKHLHYRIIDVSTVKELCRRWYPEEYEFAPKKAASHRALDDISESIKELQFY*
Applicable Applications for anti-REXO2 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Dilution: ELISA: 1ng/ml
Immunogen
Partial recombinant corresponding to aa101-211 from human REXO2 (NP_056338) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD))

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD))

Testing Data

(Detection limit for recombinant GST tagged REXO2 is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged REXO2 is 1ng/ml as a capture antibody.)
Product Categories/Family for anti-REXO2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
26,833 Da
NCBI Official Full Name
REXO2 protein
NCBI Official Synonym Full Names
RNA exonuclease 2
NCBI Official Symbol
REXO2
NCBI Official Synonym Symbols
RFN; SFN; REX2; CGI-114
NCBI Protein Information
oligoribonuclease, mitochondrial; small fragment nuclease; RNA exonuclease 2 homolog; REX2, RNA exonuclease 2 homolog
UniProt Protein Name
Oligoribonuclease, mitochondrial
UniProt Gene Name
REXO2
UniProt Synonym Gene Names
SFN; SMFN
UniProt Entry Name
ORN_HUMAN

NCBI Description

This gene encodes a 3'-to-5' exonuclease specific for small (primarily 5 nucleotides or less in length) single-stranded RNA and DNA oligomers. This protein may have a role in DNA repair, replication, and recombination, and in RNA processing and degradation. It may also be involved in resistance of human cells to UV-C-induced cell death through its role in the DNA repair process. [provided by RefSeq, Nov 2011]

Uniprot Description

REXO2: a 3'-to-5' exoribonuclease specific for small oligoribonucleotides. Active on small (primarily </=5 nucleotides in length) single-stranded RNA and DNA oligomers. May have a role for cellular nucleotide recycling. Two splice variant isoforms have been described: mitochondrial (isoform 1) and nuclear (isoform 2).

Protein type: Hydrolase; EC 3.1.-.-

Chromosomal Location of Human Ortholog: 11q23.2

Cellular Component: focal adhesion; mitochondrion; mitochondrial matrix; nucleolus; mitochondrial intermembrane space; nucleus

Molecular Function: 3'-5'-exoribonuclease activity; nucleic acid binding; 3'-5' exonuclease activity

Biological Process: nucleobase, nucleoside, nucleotide and nucleic acid metabolic process; nucleotide metabolic process

Research Articles on REXO2

Similar Products

Product Notes

The REXO2 rexo2 (Catalog #AAA6000583) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The REXO2 (RNA Exonuclease 2 Homolog, REX2, CGI-114, Oligoribonuclease, Mitochondrial, RFN, Small Fragment Nuclease , SFN, SMFN) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's REXO2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Dilution: ELISA: 1ng/ml. Researchers should empirically determine the suitability of the REXO2 rexo2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: HGRSGLTKAV KESTITLQQA EYEFLSFVRQ QTPPGLCPLA GNSVHEDKKF LDKYMPQFMK HLHYRIIDVS TVKELCRRWY PEEYEFAPKK AASHRALDDI SESIKELQFY *. It is sometimes possible for the material contained within the vial of "REXO2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.