Mouse anti-Human RELT Monoclonal Antibody | anti-RELT antibody

RELT (Tumor Necrosis Factor Receptor Superfamily Member 19L, Receptor Expressed in Lymphoid Tissues, TNFRSF19L) APC

Cat. Num. AAA6138686

• Gene Names: RELT; TRLT; TNFRSF19L
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RELT; Monoclonal Antibody; RELT (Tumor Necrosis Factor Receptor Superfamily Member 19L; Receptor Expressed in Lymphoid Tissues; TNFRSF19L) APC; anti-RELT antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3F8
• Specificity: Recognizes human TNFRSF19L.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-RELT antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa26-125 from human TNFRSF19L (NP_116260) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: STTLWQCPPGEEPDLDPGQGTLCRPCPPGTFSAAWGSSPCQPHARCSLWRRLEAQVGMATRDTLCGDCWPGWFGPWGVPRVPCQPCSWAPLGTHGCDEW
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(Western Blot analysis of TNFRSF19L expression in transfected 293T cell line by TNFRSF19L monoclonal antibody. Lane 1: TNFRSF19L transfected lysate (46.1kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged RELT is 0.1ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of TNFRSF19L over-expressed 293 cell line, cotransfected with TNFRSF19L Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with TNFRSF19L monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Related Product Information for anti-RELT antibody

The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is especially abundant in hematologic tissues. It has been shown to activate the NF-kappaB pathway and selectively bind TNF receptor-associated factor 1 (TRAF1). This receptor is capable of stimulating T-cell proliferation in the presence of CD3 signaling, which suggests its regulatory role in immune response. Two alternatively spliced transcript variants of this gene encoding the same protein have been reported.

Product Categories/Family for anti-RELT antibody

Antibodies; Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 21361873
• NCBI GeneID: 84957
• NCBI Accession #: NP_116260
• NCBI GenBank Nucleotide #: NM_032871
• UniProt Accession #: Q969Z4; Q86V34; Q96JU1; Q9BUX7
• Molecular Weight: 46,092 Da
• NCBI Official Full Name: tumor necrosis factor receptor superfamily member 19L
• NCBI Official Synonym Full Names: RELT tumor necrosis factor receptor
• NCBI Official Symbol: RELT
• NCBI Official Synonym Symbols: TRLT; TNFRSF19L
• NCBI Protein Information: tumor necrosis factor receptor superfamily member 19L; receptor expressed in lymphoid tissues
• UniProt Protein Name: Tumor necrosis factor receptor superfamily member 19L
• Protein Family: RELT-like protein
• UniProt Gene Name: RELT
• UniProt Synonym Gene Names: TNFRSF19L
• UniProt Entry Name: TR19L_HUMAN

Uniprot Description

RELT: Mediates activation of NF-kappa-B. May play a role in T- cell activation. Belongs to the RELT family.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 11q13.4

Cellular Component: cytoplasm; integral to membrane; plasma membrane