Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of RCV1 expression in transfected 293T cell line by RCV1 monoclonal antibody (M13), clone 1B9.Lane 1: RCV1 transfected lysate(22.999 KDa).Lane 2: Non-transfected lysate.)

Mouse RCV1 Monoclonal Antibody | anti-RCV1 antibody

RCV1 (Recoverin, RCV1) (AP)

Gene Names
RCVRN; RCV1
Applications
Western Blot
Purity
Purified
Synonyms
RCV1; Monoclonal Antibody; RCV1 (Recoverin; RCV1) (AP); Recoverin; anti-RCV1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1B9
Specificity
Recognizes RCV1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-RCV1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
RCV1 (NP_002894.1, 101aa-199aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMITPEDVKLLPDDENTPEKRAEKIWKYFGKNDDDKLTEKEFIEGTLANKEILRLIQFEPQKVKEKMKN
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of RCV1 expression in transfected 293T cell line by RCV1 monoclonal antibody (M13), clone 1B9.Lane 1: RCV1 transfected lysate(22.999 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of RCV1 expression in transfected 293T cell line by RCV1 monoclonal antibody (M13), clone 1B9.Lane 1: RCV1 transfected lysate(22.999 KDa).Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged RCV1 is approximately 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged RCV1 is approximately 0.1ng/ml as a capture antibody.)
Related Product Information for anti-RCV1 antibody
This gene encodes a member of the recoverin family of neuronal calcium sensors. The encoded protein contains three calcium-binding EF-hand domains and may prolong the termination of the phototransduction cascade in the retina by blocking the phosphorylation of photo-activated rhodopsin. Recoverin may be the antigen responsible for cancer-associated retinopathy. [provided by RefSeq]
Product Categories/Family for anti-RCV1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23,130 Da
NCBI Official Full Name
recoverin
NCBI Official Synonym Full Names
recoverin
NCBI Official Symbol
RCVRN
NCBI Official Synonym Symbols
RCV1
NCBI Protein Information
recoverin; cancer associated retinopathy antigen; cancer-associated retinopathy protein
UniProt Protein Name
Recoverin
UniProt Gene Name
RCVRN
UniProt Synonym Gene Names
RCV1; Protein CAR
UniProt Entry Name
RECO_HUMAN

NCBI Description

This gene encodes a member of the recoverin family of neuronal calcium sensors. The encoded protein contains three calcium-binding EF-hand domains and may prolong the termination of the phototransduction cascade in the retina by blocking the phosphorylation of photo-activated rhodopsin. Recoverin may be the antigen responsible for cancer-associated retinopathy. [provided by RefSeq, Jul 2008]

Uniprot Description

RCV1: Seems to be implicated in the pathway from retinal rod guanylate cyclase to rhodopsin. May be involved in the inhibition of the phosphorylation of rhodopsin in a calcium-dependent manner. The calcium-bound recoverin prolongs the photoresponse. Belongs to the recoverin family.

Protein type: Calcium-binding

Chromosomal Location of Human Ortholog: 17p13.1

Cellular Component: dendrite

Molecular Function: calcium sensitive guanylate cyclase activator activity; calcium ion binding

Biological Process: rhodopsin mediated signaling; phototransduction, visible light; regulation of rhodopsin mediated signaling; visual perception; positive regulation of guanylate cyclase activity; regulation of calcium ion transport; signal transduction

Research Articles on RCV1

Similar Products

Product Notes

The RCV1 rcvrn (Catalog #AAA6163493) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's RCV1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RCV1 rcvrn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RCV1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.