Mouse anti-Human RBP3 Monoclonal Antibody | anti-RBP3 antibody

RBP3 (Retinol-binding Protein 3, Interphotoreceptor Retinoid-binding Protein, IRBP, Interstitial Retinol-binding Protein) (AP)

Cat. Num. AAA6133363

• Gene Names: RBP3; IRBP; RBPI; RP66; D10S64; D10S65; D10S66
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RBP3; Monoclonal Antibody; RBP3 (Retinol-binding Protein 3; Interphotoreceptor Retinoid-binding Protein; IRBP; Interstitial Retinol-binding Protein) (AP); anti-RBP3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4F3
• Specificity: Recognizes human RBP3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
• Sequence Length: 1247

• Applicable Applications for anti-RBP3 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1149-1247, from human RBP3 (NP_002891) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: GTAEEFTYIMKRLGRALVIGEVTSGGCQPPQTYHVDDTNLYLTIPTARSVGASDGSSWEGVGVTPHVVVPAEEALARAKEMLQHNQLRVKRSPGLQDH
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged RBP3 is ~1ng/ml as a capture antibody.)

Related Product Information for anti-RBP3 antibody

IRBP shuttles 11-cis and all trans retinoids between the retinol isomerase in the pigment epithelium and the visual pigments in the photoreceptor cells of the retina.

Product Categories/Family for anti-RBP3 antibody

Antibodies; Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 4506453
• NCBI GeneID: 5949
• NCBI Accession #: NP_002891
• NCBI GenBank Nucleotide #: NM_002900
• UniProt Accession #: P10745
• NCBI Official Full Name: retinol-binding protein 3
• NCBI Official Synonym Full Names: retinol binding protein 3
• NCBI Official Symbol: RBP3
• NCBI Official Synonym Symbols: IRBP; RBPI; RP66; D10S64; D10S65; D10S66
• NCBI Protein Information: retinol-binding protein 3
• UniProt Protein Name: Retinol-binding protein 3
• Protein Family: Retinol-binding protein
• UniProt Gene Name: RBP3
• UniProt Synonym Gene Names: IRBP
• UniProt Entry Name: RET3_HUMAN

NCBI Description

Interphotoreceptor retinol-binding protein is a large glycoprotein known to bind retinoids and found primarily in the interphotoreceptor matrix of the retina between the retinal pigment epithelium and the photoreceptor cells. It is thought to transport retinoids between the retinal pigment epithelium and the photoreceptors, a critical role in the visual process.The human IRBP gene is approximately 9.5 kbp in length and consists of four exons separated by three introns. The introns are 1.6-1.9 kbp long. The gene is transcribed by photoreceptor and retinoblastoma cells into an approximately 4.3-kilobase mRNA that is translated and processed into a glycosylated protein of 135,000 Da. The amino acid sequence of human IRBP can be divided into four contiguous homology domains with 33-38% identity, suggesting a series of gene duplication events. In the gene, the boundaries of these domains are not defined by exon-intron junctions, as might have been expected. The first three homology domains and part of the fourth are all encoded by the first large exon, which is 3,180 base pairs long. The remainder of the fourth domain is encoded in the last three exons, which are 191, 143, and approximately 740 base pairs long, respectively. [provided by RefSeq, Jul 2008]