Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of RBM6 expression in transfected 293T cell line by RBM6 monoclonal antibody (M16), clone 4B3.Lane 1: RBM6 transfected lysate (69.2 KDa).Lane 2: Non-transfected lysate.)

Mouse RBM6 Monoclonal Antibody | anti-RBM6 antibody

RBM6 (RNA Binding Motif Protein 6, 3G2, DEF-3, DEF3, DKFZp686B0877, FLJ36517, HLC-11, NY-LU-12, g16) (Biotin)

Gene Names
RBM6; 3G2; g16; DEF3; DEF-3; HLC-11; NY-LU-12
Applications
Western Blot
Purity
Purified
Synonyms
RBM6; Monoclonal Antibody; RBM6 (RNA Binding Motif Protein 6; 3G2; DEF-3; DEF3; DKFZp686B0877; FLJ36517; HLC-11; NY-LU-12; g16) (Biotin); RNA Binding Motif Protein 6; g16; anti-RBM6 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4B3
Specificity
Recognizes RBM6.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-RBM6 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
RBM6 (NP_005768.1, 1024aa-1123aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DSPERKRIKYSRETDSDRKLVDKEDIDTSSKGGCVQQATGWRKGTGLGYGHPGLASSEEAEGRMRGPSVGASGRTSKRQSNETYRDAVRRVMFARYKELD
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of RBM6 expression in transfected 293T cell line by RBM6 monoclonal antibody (M16), clone 4B3.Lane 1: RBM6 transfected lysate (69.2 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of RBM6 expression in transfected 293T cell line by RBM6 monoclonal antibody (M16), clone 4B3.Lane 1: RBM6 transfected lysate (69.2 KDa).Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged RBM6 is 0.3 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged RBM6 is 0.3 ng/ml as a capture antibody.)
Related Product Information for anti-RBM6 antibody
Mouse monoclonal antibody raised against a partial recombinant RBM6.
Product Categories/Family for anti-RBM6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
69,179 Da
NCBI Official Full Name
RNA-binding protein 6 isoform 1
NCBI Official Synonym Full Names
RNA binding motif protein 6
NCBI Official Symbol
RBM6
NCBI Official Synonym Symbols
3G2; g16; DEF3; DEF-3; HLC-11; NY-LU-12
NCBI Protein Information
RNA-binding protein 6; RNA-binding protein DEF-3; RNA-binding motif protein 6; lung cancer antigen NY-LU-12; lung cancer protooncogene 11
Protein Family

Research Articles on RBM6

Similar Products

Product Notes

The RBM6 (Catalog #AAA6173311) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's RBM6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RBM6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RBM6, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.