Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (RNPC2 monoclonal antibody Western Blot analysis of RNPC2 expression in NIH/3T3)

Mouse anti-Human, Mouse RBM39 Monoclonal Antibody | anti-RBM39 antibody

RBM39 (HCC1, RNPC2, RNA-binding Protein 39, Hepatocellular Carcinoma Protein 1, RNA-binding Motif Protein 39, RNA-binding Region-containing Protein 2, Splicing Factor HCC1) (FITC)

Gene Names
RBM39; HCC1; CAPER; RNPC2; FSAP59; CAPERalpha
Reactivity
Human, Mouse
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RBM39; Monoclonal Antibody; RBM39 (HCC1; RNPC2; RNA-binding Protein 39; Hepatocellular Carcinoma Protein 1; RNA-binding Motif Protein 39; RNA-binding Region-containing Protein 2; Splicing Factor HCC1) (FITC); anti-RBM39 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4G8
Specificity
Recognizes human RNPC2. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
530
Applicable Applications for anti-RBM39 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 40ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa423-472 from RNPC2 (NP_909122) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQG
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(RNPC2 monoclonal antibody Western Blot analysis of RNPC2 expression in NIH/3T3)

Western Blot (WB) (RNPC2 monoclonal antibody Western Blot analysis of RNPC2 expression in NIH/3T3)

Western Blot (WB)

(Western Blot analysis of RBM39 expression in transfected 293T cell line by RNPC2 monoclonal antibody. Lane 1: RBM39 transfected lysate (58.7kD). Lane 2: Non-transfected lysate. )

Western Blot (WB) (Western Blot analysis of RBM39 expression in transfected 293T cell line by RNPC2 monoclonal antibody. Lane 1: RBM39 transfected lysate (58.7kD). Lane 2: Non-transfected lysate. )

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to RNPC2 on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 1ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to RNPC2 on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 1ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to RNPC2 on HeLa cell. [antibody concentration 40ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to RNPC2 on HeLa cell. [antibody concentration 40ug/ml])

Testing Data

(Detection limit for recombinant GST tagged RNPC2 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged RNPC2 is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-RBM39 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
RNA-binding protein 39 isoform a
NCBI Official Synonym Full Names
RNA binding motif protein 39
NCBI Official Symbol
RBM39
NCBI Official Synonym Symbols
HCC1; CAPER; RNPC2; FSAP59; CAPERalpha
NCBI Protein Information
RNA-binding protein 39
UniProt Protein Name
RNA-binding protein 39
Protein Family
UniProt Gene Name
RBM39
UniProt Synonym Gene Names
HCC1; RNPC2
UniProt Entry Name
RBM39_HUMAN

NCBI Description

This gene encodes a member of the U2AF65 family of proteins. The encoded protein is found in the nucleus, where it co-localizes with core spliceosomal proteins. It has been shown to play a role in both steroid hormone receptor-mediated transcription and alternative splicing, and it is also a transcriptional coregulator of the viral oncoprotein v-Rel. Multiple transcript variants have been observed for this gene. A related pseudogene has been identified on chromosome X. [provided by RefSeq, Aug 2011]

Uniprot Description

RNPC2: Transcriptional coactivator for steroid nuclear receptors ESR1/ER-alpha and ESR2/ER-beta, and JUN/AP-1. May be involved in pre-mRNA splicing process. Belongs to the splicing factor SR family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Nuclear receptor co-regulator; RNA-binding; Spliceosome

Chromosomal Location of Human Ortholog: 20q11.22

Cellular Component: microtubule cytoskeleton; nucleoplasm; microtubule organizing center; nuclear speck

Molecular Function: protein binding; nucleotide binding

Biological Process: RNA processing; regulation of transcription, DNA-dependent; transcription, DNA-dependent; RNA splicing; mRNA processing

Research Articles on RBM39

Similar Products

Product Notes

The RBM39 rbm39 (Catalog #AAA6149263) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RBM39 (HCC1, RNPC2, RNA-binding Protein 39, Hepatocellular Carcinoma Protein 1, RNA-binding Motif Protein 39, RNA-binding Region-containing Protein 2, Splicing Factor HCC1) (FITC) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's RBM39 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 40ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RBM39 rbm39 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RBM39, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.