Mouse anti-Human RBL1 Monoclonal Antibody | anti-RBL1 antibody

RBL1 (RB-like 1, Retinoblastoma-like Protein 1, 107kD Retinoblastoma-associated Protein, PRB1, P107, MGC40006) (FITC)

Cat. Num. AAA6149257

• Gene Names: RBL1; PRB1; p107; CP107
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RBL1; Monoclonal Antibody; RBL1 (RB-like 1; Retinoblastoma-like Protein 1; 107kD Retinoblastoma-associated Protein; PRB1; P107; MGC40006) (FITC); anti-RBL1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1A5
• Specificity: Recognizes human RBL1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-RBL1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa905-1014, from human RBL1 (AAH32247) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: IDCDLEDATKTPDCSSGPVKEERGDLIKFYNTIYVGRVKSFALKYDLANQDHMMDAPPLSPFPHIKQQPGSPRRISQQHSIYISPHKNGSGLTPRSALLYKFNGSPSKVR
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between MYBL2 and RBL1. Mahlavu cells were stained with MYBL2 rabbit purified polyclonal 1:1200 and RBL1 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Related Product Information for anti-RBL1 antibody

RB-like 1 is similar in sequence and possibly function to the product of the retinoblastoma 1 (RB1) gene. The RB1 gene product is a tumor suppressor protein that appears to be involved in cell cycle regulation, as it is phosphorylated in the S to M phase transition and is dephosphorylated in the G1 phase of the cell cycle. Both the RB1 protein and RB-like 1 can form a complex with adenovirus E1A protein and SV40 large T-antigen, with the SV40 large T-antigen binding only to the unphosphorylated form of each protein. In addition, both proteins can inhibit the transcription of cell cycle genes containing E2F binding sites in their promoters. Due to the sequence and biochemical similarities with the RB1 protein, it is thought that RB-like 1 may also be a tumor suppressor.

Product Categories/Family for anti-RBL1 antibody

Antibodies; Retinoblastoma Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 21595245
• NCBI GeneID: 5933
• Molecular Weight: 114,688 Da
• NCBI Official Full Name: Homo sapiens retinoblastoma-like 1 (p107), mRNA
• NCBI Official Synonym Full Names: RB transcriptional corepressor like 1
• NCBI Official Symbol: RBL1
• NCBI Official Synonym Symbols: PRB1; p107; CP107
• NCBI Protein Information: retinoblastoma-like protein 1
• Protein Family: RHOMBOID-like protein

NCBI Description

The protein encoded by this gene is similar in sequence and possibly function to the product of the retinoblastoma 1 (RB1) gene. The RB1 gene product is a tumor suppressor protein that appears to be involved in cell cycle regulation, as it is phosphorylated in the S to M phase transition and is dephosphorylated in the G1 phase of the cell cycle. Both the RB1 protein and the product of this gene can form a complex with adenovirus E1A protein and SV40 large T-antigen, with the SV40 large T-antigen binding only to the unphosphorylated form of each protein. In addition, both proteins can inhibit the transcription of cell cycle genes containing E2F binding sites in their promoters. Due to the sequence and biochemical similarities with the RB1 protein, it is thought that the protein encoded by this gene may also be a tumor suppressor. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]