Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human RBBP9 Monoclonal Antibody | anti-RBBP9 antibody

RBBP9 (Retinoblastoma-binding Protein 9, RBBP-9, Putative Hydrolase RBBP9, B5T-overexpressed Gene Protein, BOG, Protein BOG, Retinoblastoma-binding Protein 10, RBBP10, RBBP-10) (MaxLight 490)

Gene Names
RBBP9; BOG; RBBP10
Reactivity
Human
Applications
Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RBBP9; Monoclonal Antibody; RBBP9 (Retinoblastoma-binding Protein 9; RBBP-9; Putative Hydrolase RBBP9; B5T-overexpressed Gene Protein; BOG; Protein BOG; Retinoblastoma-binding Protein 10; RBBP10; RBBP-10) (MaxLight 490); EC=3.-.-.-; MGC9236; anti-RBBP9 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2A11
Specificity
Recognizes human RBBP9.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Applicable Applications for anti-RBBP9 antibody
FLISA, Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa87-185 from human RBBP9 (NP_006597) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
THRVYAIVLVSAYTSDLGDENERASGYFTRPWQWEKIKANCPYIVQFGSTDDPFLPWKEQQEVADRLETKLHKFTDCGHFQNTEFHELITVVKSLLKVP
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-RBBP9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23.1 kDa (206aa), confirmed by MALDI-TOF
NCBI Official Full Name
putative hydrolase RBBP9
NCBI Official Synonym Full Names
RB binding protein 9, serine hydrolase
NCBI Official Symbol
RBBP9
NCBI Official Synonym Symbols
BOG; RBBP10
NCBI Protein Information
putative hydrolase RBBP9
UniProt Protein Name
Putative hydrolase RBBP9
Protein Family
UniProt Gene Name
RBBP9
UniProt Synonym Gene Names
BOG; RBBP10; Protein BOG; RBBP-10; RBBP-9
UniProt Entry Name
RBBP9_HUMAN

NCBI Description

The protein encoded by this gene is a retinoblastoma binding protein that may play a role in the regulation of cell proliferation and differentiation. Two alternatively spliced transcript variants of this gene with identical predicted protein products have been reported, one of which is a nonsense-mediated decay candidate. [provided by RefSeq, Jul 2008]

Uniprot Description

RBBP9: May play a role in the transformation process due to its capacity to confer resistance to the growth-inhibitory effects of TGF-beta1 through interaction with retinoblastoma and the subsequent displacement of E2F-1. Belongs to the RBBP9 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Hydrolase; EC 3.-.-.-

Chromosomal Location of Human Ortholog: 20p11.2

Cellular Component: nucleoplasm; cytoplasm; nucleolus; nucleus

Molecular Function: hydrolase activity

Biological Process: metabolic process; regulation of cell proliferation

Research Articles on RBBP9

Similar Products

Product Notes

The RBBP9 rbbp9 (Catalog #AAA6202883) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RBBP9 (Retinoblastoma-binding Protein 9, RBBP-9, Putative Hydrolase RBBP9, B5T-overexpressed Gene Protein, BOG, Protein BOG, Retinoblastoma-binding Protein 10, RBBP10, RBBP-10) (MaxLight 490) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RBBP9 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RBBP9 rbbp9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RBBP9, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.