Mouse anti-Human RBBP6 Monoclonal Antibody | anti-RBBP6 antibody

RBBP6 (Retinoblastoma-binding Protein 6, p53-associated Cellular Protein of Testis, Proliferation Potential-related Protein, Protein P2P-R, Retinoblastoma-binding Q Protein 1, RBQ-1, P2PR, PACT, RBQ1, My038) (HRP)

Cat. Num. AAA6154555

• Gene Names: RBBP6; PACT; MY038; P2P-R; RBQ-1; SNAMA
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RBBP6; Monoclonal Antibody; RBBP6 (Retinoblastoma-binding Protein 6; p53-associated Cellular Protein of Testis; Proliferation Potential-related Protein; Protein P2P-R; Retinoblastoma-binding Q Protein 1; RBQ-1; P2PR; PACT; RBQ1; My038) (HRP); anti-RBBP6 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 5A11
• Specificity: Recognizes human RBBP6.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-RBBP6 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1582-1692, from human RBBP6 (NP_008841) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SSGNKLLYILNPPETQVEKEQITGQIDKSTVKPKPQLSHSSRLSSDLTRETDEAAFEPDYNESDSESNVSVKEEESSGNISKDLKDKIVEKAKESLDTAAVVQVGISRNQ
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to RBBP6 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to RBBP6 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged RBBP6 is ~0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-RBBP6 antibody

Antibodies; Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 33620769
• NCBI GeneID: 5930
• NCBI Accession #: NP_008841
• NCBI GenBank Nucleotide #: NM_006910
• UniProt Accession #: Q7Z6E9
• Molecular Weight: 201kDa
• NCBI Official Full Name: E3 ubiquitin-protein ligase RBBP6 isoform 1
• NCBI Official Synonym Full Names: RB binding protein 6, ubiquitin ligase
• NCBI Official Symbol: RBBP6
• NCBI Official Synonym Symbols: PACT; MY038; P2P-R; RBQ-1; SNAMA
• NCBI Protein Information: E3 ubiquitin-protein ligase RBBP6
• UniProt Protein Name: E3 ubiquitin-protein ligase RBBP6
• Protein Family: E3 ubiquitin-protein ligase
• UniProt Gene Name: RBBP6
• UniProt Synonym Gene Names: P2PR; PACT; RBQ1
• UniProt Entry Name: RBBP6_HUMAN

NCBI Description

The retinoblastoma tumor suppressor (pRB) protein binds with many other proteins. In various human cancers, pRB suppresses cellular proliferation and is inactivated. Cell cycle-dependent phosphorylation regulates the activity of pRB. This gene encodes a protein which binds to underphosphorylated but not phosphorylated pRB. Multiple alternatively spliced transcript variants that encode different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]