Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (RARRES1 monoclonal antibody. Western Blot analysis of RARRES1 expression in HL-60.)

Mouse anti-Human RARRES1 Monoclonal Antibody | anti-RARRES1 antibody

RARRES1 (TIG1, Retinoic Acid Receptor Responder Protein 1, RAR-responsive Protein TIG1, Tazarotene-induced Gene 1 Protein) (HRP)

Gene Names
RARRES1; LXNL; TIG1; PERG-1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RARRES1; Monoclonal Antibody; RARRES1 (TIG1; Retinoic Acid Receptor Responder Protein 1; RAR-responsive Protein TIG1; Tazarotene-induced Gene 1 Protein) (HRP); anti-RARRES1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2E2
Specificity
Recognizes human RARRES1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-RARRES1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa205-295, from human RARRES1 (NP_996846) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EMTTQVSHYYLAQLTSVRQWKTNDDTIDFDYTVLLHELSTQEIIPCRIHLVWYPGKPLKVKYHCQELQTPEEASGTEEGSAVVPTELSNF
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(RARRES1 monoclonal antibody. Western Blot analysis of RARRES1 expression in HL-60.)

Western Blot (WB) (RARRES1 monoclonal antibody. Western Blot analysis of RARRES1 expression in HL-60.)

Testing Data

(Detection limit for recombinant GST tagged RARRES1 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged RARRES1 is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-RARRES1 antibody
This gene was identified as a retinoid acid (RA) receptor-responsive gene. It encodes a type 1 membrane protein. The expression of this gene is upregulated by tazarotene as well as by retinoic acid receptors. The expression of this gene is found to be downregulated in prostate cancer, which is caused by the methylation of its promoter and CpG island. Alternatively spliced transcript variant encoding distinct isoforms have been observed.
Product Categories/Family for anti-RARRES1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31.3kDa (275aa)
NCBI Official Full Name
retinoic acid receptor responder protein 1 isoform 1
NCBI Official Synonym Full Names
retinoic acid receptor responder 1
NCBI Official Symbol
RARRES1
NCBI Official Synonym Symbols
LXNL; TIG1; PERG-1
NCBI Protein Information
retinoic acid receptor responder protein 1
UniProt Protein Name
Retinoic acid receptor responder protein 1
UniProt Gene Name
RARRES1
UniProt Synonym Gene Names
TIG1
UniProt Entry Name
TIG1_HUMAN

NCBI Description

This gene was identified as a retinoid acid (RA) receptor-responsive gene. It encodes a type 1 membrane protein. The expression of this gene is upregulated by tazarotene as well as by retinoic acid receptors. The expression of this gene is found to be downregulated in prostate cancer, which is caused by the methylation of its promoter and CpG island. Alternatively spliced transcript variant encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008]

Uniprot Description

RARRES1: identified as a retinoid acid (RA) receptor-responsive gene. It encodes a type 1 membrane protein. The expression of this gene is upregulated by tazarotene as well as by retinoic acid receptors. The expression of this gene is found to be downregulated in prostate cancer, which is caused by the methylation of its promoter and CpG island. Alternatively spliced transcript variant encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008]

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 3q25.32

Cellular Component: integral to membrane

Biological Process: negative regulation of cell proliferation

Research Articles on RARRES1

Similar Products

Product Notes

The RARRES1 rarres1 (Catalog #AAA6154534) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RARRES1 (TIG1, Retinoic Acid Receptor Responder Protein 1, RAR-responsive Protein TIG1, Tazarotene-induced Gene 1 Protein) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RARRES1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RARRES1 rarres1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RARRES1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.