Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for is ~0.03ng/ml as a capture antibody.)

Mouse anti-Human RAMP3 Monoclonal Antibody | anti-RAMP3 antibody

RAMP3 (Receptor Activity-modifying Protein 3, Calcitonin-receptor-like Receptor Activity-modifying Protein 3, CRLR Activity-modifying Protein 3) (MaxLight 405)

Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RAMP3; Monoclonal Antibody; RAMP3 (Receptor Activity-modifying Protein 3; Calcitonin-receptor-like Receptor Activity-modifying Protein 3; CRLR Activity-modifying Protein 3) (MaxLight 405); anti-RAMP3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1C11
Specificity
Recognizes human RAMP3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Sequence Length
148
Applicable Applications for anti-RAMP3 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant protein corresponding to aa24-148 of human RAMP3 (AAH22304; BC022304) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RAGGCNETGMLERLPLCGKAFADMMGKVDVWKWCNLSEFIVYYESFTNCTEMEANVVGCYWPNPLAQGFITGIHRQFFSNCTVDRVHLEDPPDEVLIPLIVIPVVLTVAMAGLVVWRSKRTDTLL
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-RAMP3 antibody
RAMP3 (receptor calcitonin activity modifying protein 3) transports the calcitonin gene-related peptide type 1 receptor (CALCRL) to the plasma membrane. It acts as a receptor for adrenomedullin (AM) together with CALCRL. It is strongly expressed in lung, breast, immune system and fetal tissues and belongs to the RAMP family.
Product Categories/Family for anti-RAMP3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Receptor (G protein-coupled) activity modifying protein 3
NCBI Official Synonym Full Names
receptor activity modifying protein 3
NCBI Official Symbol
RAMP3
NCBI Protein Information
receptor activity-modifying protein 3

NCBI Description

The protein encoded by this gene is a member of the RAMP family of single-transmembrane-domain proteins, called receptor (calcitonin) activity modifying proteins (RAMPs). RAMPs are type I transmembrane proteins with an extracellular N terminus and a cytoplasmic C terminus. RAMPs are required to transport calcitonin-receptor-like receptor (CRLR) to the plasma membrane. CRLR, a receptor with seven transmembrane domains, can function as either a calcitonin-gene-related peptide (CGRP) receptor or an adrenomedullin receptor, depending on which members of the RAMP family are expressed. In the presence of this (RAMP3) protein, CRLR functions as an adrenomedullin receptor. [provided by RefSeq, Jul 2008]

Research Articles on RAMP3

Similar Products

Product Notes

The RAMP3 (Catalog #AAA6192171) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RAMP3 (Receptor Activity-modifying Protein 3, Calcitonin-receptor-like Receptor Activity-modifying Protein 3, CRLR Activity-modifying Protein 3) (MaxLight 405) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RAMP3 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RAMP3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RAMP3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.