Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged RAD23A is ~0.03ng/ml as a capture antibody.)

Mouse anti-Human RAD23A Monoclonal Antibody | anti-RAD23A antibody

RAD23A (UV Excision Repair Protein RAD23 Homolog A, HR23A, hHR23A, MGC111083) (PE)

Gene Names
RAD23A; HR23A; HHR23A
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RAD23A; Monoclonal Antibody; RAD23A (UV Excision Repair Protein RAD23 Homolog A; HR23A; hHR23A; MGC111083) (PE); anti-RAD23A antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3C12
Specificity
Recognizes human RAD23A.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-RAD23A antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa151-250, from human RAD23A (AAH14026) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EDAASTLVTGSEYETMLTEIMSMGYERERVVAALRASYNNPHRAVEYLLTGIPGSPEPEHGSVQESQVSEQPATEAAGENPLEFLRDQPQFQNMRQVIQQ
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged RAD23A is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged RAD23A is ~0.03ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of RAD23A over-expressed 293 cell line, cotransfected with RAD23A Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with RAD23A monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of RAD23A over-expressed 293 cell line, cotransfected with RAD23A Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with RAD23A monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)
Related Product Information for anti-RAD23A antibody
The protein encoded by this gene is one of two human homologs of Saccharomyces cerevisiae Rad23, a protein involved in nucleotide excision repair (NER). This protein was shown to interact with, and elevate the nucleotide excision activity of 3-methyladenine-DNA glycosylase (MPG), which suggested a role in DNA damage recognition in base excision repair. This protein contains an N-terminal ubiquitin-like domain, which was reported to interact with 26S proteasome, as well as with ubiquitin protein ligase E6AP, and thus suggests that this protein may be involved in the ubiquitin mediated proteolytic pathway in cells. [provided by RefSeq].
Product Categories/Family for anti-RAD23A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
39,538 Da
NCBI Official Full Name
Homo sapiens RAD23 homolog A (S. cerevisiae), mRNA
NCBI Official Synonym Full Names
RAD23 homolog A, nucleotide excision repair protein
NCBI Official Symbol
RAD23A
NCBI Official Synonym Symbols
HR23A; HHR23A
NCBI Protein Information
UV excision repair protein RAD23 homolog A
UniProt Protein Name
UV excision repair protein RAD23 homolog A
UniProt Gene Name
RAD23A
UniProt Synonym Gene Names
HR23A; hHR23A
UniProt Entry Name
RD23A_HUMAN

NCBI Description

The protein encoded by this gene is one of two human homologs of Saccharomyces cerevisiae Rad23, a protein involved in nucleotide excision repair. Proteins in this family have a modular domain structure consisting of an ubiquitin-like domain (UbL), ubiquitin-associated domain 1 (UbA1), XPC-binding domain and UbA2. The protein encoded by this gene plays an important role in nucleotide excision repair and also in delivery of polyubiquitinated proteins to the proteasome. Alternative splicing results in multiple transcript variants encoding multiple isoforms. [provided by RefSeq, Jun 2012]

Uniprot Description

RAD23A: Multiubiquitin chain receptor involved in modulation of proteasomal degradation. Binds to 'Lys-48'-linked polyubiquitin chains in a length-dependent manner and with a lower affinity to 'Lys-63'-linked polyubiquitin chains. Proposed to be capable to bind simultaneously to the 26S proteasome and to polyubiquitinated substrates and to deliver ubiquitinated proteins to the proteasome. Belongs to the RAD23 family.

Protein type: DNA repair, damage; DNA-binding

Chromosomal Location of Human Ortholog: 19p13.2

Cellular Component: proteasome complex; nucleoplasm; cytoplasm

Molecular Function: protein binding; damaged DNA binding; polyubiquitin binding; single-stranded DNA binding

Biological Process: proteasomal ubiquitin-dependent protein catabolic process; positive regulation of viral genome replication; viral reproduction; nucleotide-excision repair; regulation of proteasomal ubiquitin-dependent protein catabolic process

Research Articles on RAD23A

Similar Products

Product Notes

The RAD23A rad23a (Catalog #AAA6159808) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RAD23A (UV Excision Repair Protein RAD23 Homolog A, HR23A, hHR23A, MGC111083) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RAD23A can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RAD23A rad23a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RAD23A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.