Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (RAB4A monoclonal antibody, Western Blot analysis of RAB4A expression in Hela.)

Mouse anti-Human RAB4A Monoclonal Antibody | anti-RAB4A antibody

RAB4A (Ras-related Protein Rab-4A, RAB4) (Biotin)

Gene Names
RAB4A; RAB4; HRES1; HRES-1; HRES-1/RAB4
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RAB4A; Monoclonal Antibody; RAB4A (Ras-related Protein Rab-4A; RAB4) (Biotin); anti-RAB4A antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1C10
Specificity
Recognizes human RAB4A.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
1861
Applicable Applications for anti-RAB4A antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to human RAB4A, aa1-219 (AAH04309) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSQTAMSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESGELDPERMGSGIQYGDAALRQLRSPRRAQAPNAQECGC
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(RAB4A monoclonal antibody, Western Blot analysis of RAB4A expression in Hela.)

Western Blot (WB) (RAB4A monoclonal antibody, Western Blot analysis of RAB4A expression in Hela.)

Western Blot (WB)

(Western Blot analysis of RAB4A expression in transfected 293T cell line by RAB4A monoclonal antibody. Lane 1: RAB4A transfected lysate (24.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of RAB4A expression in transfected 293T cell line by RAB4A monoclonal antibody. Lane 1: RAB4A transfected lysate (24.4kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged RAB4A is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged RAB4A is ~0.1ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of RAB4A over-expressed 293 cell line, cotransfected with RAB4A Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with RAB4A monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of RAB4A over-expressed 293 cell line, cotransfected with RAB4A Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with RAB4A monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)
Related Product Information for anti-RAB4A antibody
RAB4A belongs to the small GTPase superfamily. RAB4A has been shown to interact with STX4, RAB11FIP1, RABEP1, CD2AP and KIF3B. Rab4 is also involved in the translocation of glucose transporter (Glu4) in adipocytes in response to insulin. Overexpression of Rab4 causes a redistribution of receptors on plasma membrane versus endocytic compartments.
Product Categories/Family for anti-RAB4A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens RAB4A, member RAS oncogene family, mRNA
NCBI Official Synonym Full Names
RAB4A, member RAS oncogene family
NCBI Official Symbol
RAB4A
NCBI Official Synonym Symbols
RAB4; HRES1; HRES-1; HRES-1/RAB4
NCBI Protein Information
ras-related protein Rab-4A
Protein Family

NCBI Description

This gene is a member of the largest group in the Ras superfamily of small GTPases, which regulate membrane trafficking. The encoded protein is associated with early endosomes and is involved in their sorting and recycling. The protein also plays a role in regulating the recycling of receptors from endosomes to the plasma membrane. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Dec 2012]

Research Articles on RAB4A

Similar Products

Product Notes

The RAB4A (Catalog #AAA6143877) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RAB4A (Ras-related Protein Rab-4A, RAB4) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RAB4A can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RAB4A for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RAB4A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.