Mouse anti-Human RAB36 Monoclonal Antibody | anti-RAB36 antibody

RAB36 (Ras-related Protein Rab-36)

Cat. Num. AAA6001404

• Reactivity: Human
• Applications: ELISA, Western Blot, Immunohistochemistry, Immunofluorescence
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: RAB36; Monoclonal Antibody; RAB36 (Ras-related Protein Rab-36); Anti -RAB36 (Ras-related Protein Rab-36); anti-RAB36 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 6A6
• Specificity: Recognizes human RAB36.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: LVGTKKDLLSGAACEQAEADAVHLAREMQAEYWSVSAKTGENVKAFFSRVAALAFEQSVLQDLERQSSARLQVGNGDLIQMEGSPPETQESKRPSSLGCC

• Applicable Applications for anti-RAB36 antibody: ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
• Application Notes: Suitable for use in ELISA, Immunohistochemistry, Immunofluorescence and Western Blot.; Dilution: Immunofluorescence: 10ug/ml; Immunohistochemistry (Formalin fixed paraffin embedded): 1.5ug/ml
• Immunogen: Partial recombinant corresponding to aa234-333 from RAB36 (NP_004905) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(RAB36 monoclonal antibody Western Blot analysis of RAB36 expression in A-431)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to RAB36 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 1.5ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to RAB36 on A-431 cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged RAB36 is ~0.1ng/ml as a capture antibody.)

Related Product Information for anti-RAB36 antibody

RAB36 is a protein transport. Probably involved in vesicular traffic (By similarity).

Product Categories/Family for anti-RAB36 antibody

Antibodies; Abs to GTPase; Rab; Ras; Rho Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 47678637
• UniProt Accession #: O95755; Q2M390; Q7Z4A9; Q9UHP5
• Molecular Weight: 36,322 Da
• NCBI Official Full Name: RAB36
• UniProt Protein Name: Ras-related protein Rab-36
• Protein Family: Ras-related protein
• UniProt Gene Name: RAB36
• UniProt Entry Name: RAB36_HUMAN

Uniprot Description

RAB36: Protein transport. Probably involved in vesicular traffic. Belongs to the small GTPase superfamily. Rab family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: G protein, monomeric, Rab; G protein; G protein, monomeric

Chromosomal Location of Human Ortholog: 22q11.22

Cellular Component: Golgi membrane; Golgi apparatus

Molecular Function: GTPase activity; GDP binding; GTP binding

Biological Process: intracellular protein transport; metabolic process; Rab protein signal transduction