Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.01kD).)

Mouse RAB33B Monoclonal Antibody

RAB33B (Ras-related Protein Rab-33B, SMC2)

Reactivity
Human, Mouse, Rat
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
RAB33B; Monoclonal Antibody; RAB33B (Ras-related Protein Rab-33B; SMC2); Anti -RAB33B (Ras-related Protein Rab-33B; anti-RAB33B antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6F4
Specificity
Recognizes human RAB33B. Species Crossreactivity: mouse and rat.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
TNMASFHSLPSWIEECKQHLLANDIPRILVGNKCDLRSAIQVPTDLAQKFADTHSMPLFETSAKNPNDNDHVEAIFMTLAHKLKSHKPLM
Applicable Applications for anti-RAB33B antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa117-207 from human RAB33B (NP_112586) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.01kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.01kD).)

Western Blot (WB)

(RAB33B monoclonal antibody. Western Blot analysis of RAB33B expression in HeLa.)

Western Blot (WB) (RAB33B monoclonal antibody. Western Blot analysis of RAB33B expression in HeLa.)

Western Blot (WB)

(RAB33B monoclonal antibody. Western Blot analysis of RAB33B expression in PC-12.)

Western Blot (WB) (RAB33B monoclonal antibody. Western Blot analysis of RAB33B expression in PC-12.)

Western Blot (WB)

(RAB33B monoclonal antibody, Western Blot analysis of RAB33B expression in A-431.)

Western Blot (WB) (RAB33B monoclonal antibody, Western Blot analysis of RAB33B expression in A-431.)

Testing Data

(Detection limit for recombinant GST tagged RAB33B is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged RAB33B is ~0.03ng/ml as a capture antibody.)

Western Blot (WB)

(RAB33B monoclonal antibody. Western Blot analysis of RAB33B expression in NIH/3T3.)

Western Blot (WB) (RAB33B monoclonal antibody. Western Blot analysis of RAB33B expression in NIH/3T3.)
Product Categories/Family for anti-RAB33B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI Official Full Name
RAB33B
Protein Family

Uniprot Description

RAB33B: Protein transport. Probably involved in vesicular traffic. Belongs to the small GTPase superfamily. Rab family.

Protein type: G protein, monomeric, Rab; G protein; G protein, monomeric

Chromosomal Location of Human Ortholog: 4q28

Cellular Component: Golgi membrane; Golgi apparatus; Golgi lumen

Molecular Function: GTPase activity; protein binding; GDP binding; GTP binding

Biological Process: intra-Golgi vesicle-mediated transport; intracellular protein transport; skeletal morphogenesis; autophagy; regulation of cell growth; protein targeting to Golgi; Rab protein signal transduction; regulation of epithelial cell proliferation

Disease: Smith-mccort Dysplasia 2

Similar Products

Product Notes

The RAB33B (Catalog #AAA643162) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RAB33B (Ras-related Protein Rab-33B, SMC2) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RAB33B can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the RAB33B for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: TNMASFHSLP SWIEECKQHL LANDIPRILV GNKCDLRSAI QVPTDLAQKF ADTHSMPLFE TSAKNPNDND HVEAIFMTLA HKLKSHKPLM. It is sometimes possible for the material contained within the vial of "RAB33B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.