Western Blot (WB)
(Western Blot detection against Immunogen (36.89kD).)
Mouse anti-Human RAB26 Monoclonal Antibody | anti-RAB26 antibody
RAB26 (RAB26, Ras-related Protein Rab-26) APC
Gene Names
RAB26; V46133
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RAB26; Monoclonal Antibody; RAB26 (RAB26; Ras-related Protein Rab-26) APC; anti-RAB26 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2H1
Specificity
Recognizes human RAB26.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-RAB26 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa157-255 from human RAB26 (NP_055168) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AWLTEIHEYAQHDVALMLLGNKVDSAHERVVKREDGEKLAKEYGLPFMETSAKTGLNVDLAFTAIAKELKQRSMKAPSEPRFRLHDYVKREGRGASCC*
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (36.89kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (36.89kD).)
Testing Data
(Detection limit for recombinant GST tagged RAB26 is ~1ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged RAB26 is ~1ng/ml as a capture antibody.)
Related Product Information for anti-RAB26 antibody
The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. Mediates transport of ADRA2A and ADRA2B from the Golgi to the cell membrane. Plays a role in the maturation of zymogenic granules and in pepsinogen secretion in the stomach. Plays a role in the secretion of amylase from acinar granules in the parotid gland.
Product Categories/Family for anti-RAB26 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
21,355 Da
NCBI Official Full Name
ras-related protein Rab-26
NCBI Official Synonym Full Names
RAB26, member RAS oncogene family
NCBI Official Symbol
RAB26
NCBI Official Synonym Symbols
V46133
NCBI Protein Information
ras-related protein Rab-26; Ras-related oncogene protein
UniProt Protein Name
Ras-related protein Rab-26
Protein Family
UniProt Gene Name
RAB26
UniProt Entry Name
RAB26_HUMAN
Similar Products
Product Notes
The RAB26 rab26 (Catalog #AAA6138558) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RAB26 (RAB26, Ras-related Protein Rab-26) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RAB26 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RAB26 rab26 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RAB26, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
