Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (38.32kD).)

Mouse anti-Human RAB1B Monoclonal Antibody | anti-RAB1B antibody

RAB1B (Ras-related protein Rab-1B) (Biotin)

Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RAB1B; Monoclonal Antibody; RAB1B (Ras-related protein Rab-1B) (Biotin); anti-RAB1B antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1B2
Specificity
Recognizes human RAB1B.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-RAB1B antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa91-202 from human RAB1B (NP_112243) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPAGGGCC
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.32kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.32kD).)

Western Blot (WB)

(RAB1B monoclonal antibody. Western Blot analysis of RAB1B expression in A-431.)

Western Blot (WB) (RAB1B monoclonal antibody. Western Blot analysis of RAB1B expression in A-431.)

Western Blot (WB)

(Western Blot analysis of RAB1B expression in transfected 293T cell line by RAB1B monoclonal antibody. Lane 1: RAB1B transfected lysate (22.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of RAB1B expression in transfected 293T cell line by RAB1B monoclonal antibody. Lane 1: RAB1B transfected lysate (22.2kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to RAB1B on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to RAB1B on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged RAB1B is 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged RAB1B is 0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-RAB1B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24.3 kDa (221aa), confirmed by MALDI-TOF
NCBI Official Full Name
ras-related protein Rab-1B
NCBI Official Synonym Full Names
RAB1B, member RAS oncogene family
NCBI Official Symbol
RAB1B
NCBI Protein Information
ras-related protein Rab-1B
UniProt Protein Name
Ras-related protein Rab-1B
Protein Family
UniProt Gene Name
RAB1B
UniProt Entry Name
RAB1B_HUMAN

NCBI Description

Members of the RAB protein family, such as RAB1B, are low molecular mass monomeric GTPases localized on the cytoplasmic surfaces of distinct membrane-bound organelles. RAB1B functions in the early secretory pathway and is essential for vesicle transport between the endoplasmic reticulum (ER) and Golgi (Chen et al., 1997 [PubMed 9030196]; Alvarez et al., 2003 [PubMed 12802079]).[supplied by OMIM, Jan 2009]

Uniprot Description

RAB1B: Protein transport. Regulates vesicular transport between the endoplasmic reticulum and successive Golgi compartments. Belongs to the small GTPase superfamily. Rab family.

Protein type: G protein, monomeric, Rab; G protein; G protein, monomeric

Chromosomal Location of Human Ortholog: 11q12

Cellular Component: Golgi membrane; Golgi apparatus; endoplasmic reticulum membrane; mitochondrion; pre-autophagosomal structure membrane; ER-Golgi intermediate compartment

Molecular Function: GTPase activity; protein binding; GDP binding; GTP binding

Biological Process: intracellular protein transport; ER to Golgi vesicle-mediated transport; autophagy; virus assembly; Rab protein signal transduction

Research Articles on RAB1B

Similar Products

Product Notes

The RAB1B rab1b (Catalog #AAA6143858) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RAB1B (Ras-related protein Rab-1B) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RAB1B can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RAB1B rab1b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RAB1B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.