Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human QPRT Monoclonal Antibody | anti-QPRT antibody

QPRT (Nicotinate-nucleotide Pyrophosphorylase [Carboxylating], Quinolinate Phosphoribosyltransferase [Decarboxylating]) (MaxLight 750)

Gene Names
QPRT; QPRTase; HEL-S-90n
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
QPRT; Monoclonal Antibody; QPRT (Nicotinate-nucleotide Pyrophosphorylase [Carboxylating]; Quinolinate Phosphoribosyltransferase [Decarboxylating]) (MaxLight 750); anti-QPRT antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
5D11
Specificity
Recognizes human QPRT.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Applicable Applications for anti-QPRT antibody
FLISA, Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa198-298 from QPRT (NP_055113) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VEVECSSLQEAVQAAEAGADLVLLDNFKPEELHPTATVLKAQFPSVAVEASGGITLDNLPQFCGPHIDVISMGMLTQAAPALDFSLKLFAKEVAPVPKIH*
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-QPRT antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30,846 Da
NCBI Official Full Name
nicotinate-nucleotide pyrophosphorylase
NCBI Official Synonym Full Names
quinolinate phosphoribosyltransferase
NCBI Official Symbol
QPRT
NCBI Official Synonym Symbols
QPRTase; HEL-S-90n
NCBI Protein Information
nicotinate-nucleotide pyrophosphorylase [carboxylating]
UniProt Protein Name
Nicotinate-nucleotide pyrophosphorylase [carboxylating]
UniProt Gene Name
QPRT
UniProt Synonym Gene Names
QAPRTase; QPRTase
UniProt Entry Name
NADC_HUMAN

NCBI Description

This gene encodes a key enzyme in catabolism of quinolinate, an intermediate in the tryptophan-nicotinamide adenine dinucleotide pathway. Quinolinate acts as a most potent endogenous exitotoxin to neurons. Elevation of quinolinate levels in the brain has been linked to the pathogenesis of neurodegenerative disorders such as epilepsy, Alzheimer's disease, and Huntington's disease. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015]

Uniprot Description

QPRT: Involved in the catabolism of quinolinic acid (QA). Belongs to the NadC/ModD family.

Protein type: Transferase; Cofactor and Vitamin Metabolism - nicotinate and nicotinamide; EC 2.4.2.19

Chromosomal Location of Human Ortholog: 16p11.2

Cellular Component: cytoplasm; cytosol

Molecular Function: protein homodimerization activity; nicotinate-nucleotide diphosphorylase (carboxylating) activity

Biological Process: NAD biosynthetic process; vitamin metabolic process; NAD metabolic process; water-soluble vitamin metabolic process; protein oligomerization

Research Articles on QPRT

Similar Products

Product Notes

The QPRT qprt (Catalog #AAA6234809) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The QPRT (Nicotinate-nucleotide Pyrophosphorylase [Carboxylating], Quinolinate Phosphoribosyltransferase [Decarboxylating]) (MaxLight 750) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's QPRT can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the QPRT qprt for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "QPRT, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.