Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (PTX3 monoclonal antibody (M01), clone 5B7. Western Blot analysis of PTX3 expression in NIH/3T3 (Cat # L018V1).)

Mouse PTX3 Monoclonal Antibody | anti-PTX3 antibody

PTX3 (Pentraxin-Related Gene, rapidly Induced by IL-1 beta, TNFAIP5, TSG-14) (FITC)

Gene Names
PTX3; TSG-14; TNFAIP5
Applications
Western Blot
Purity
Purified
Synonyms
PTX3; Monoclonal Antibody; PTX3 (Pentraxin-Related Gene; rapidly Induced by IL-1 beta; TNFAIP5; TSG-14) (FITC); Pentraxin-Related Gene; TSG-14; anti-PTX3 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
5B7
Specificity
Recognizes PTX3.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-PTX3 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
PTX3 (NP_002843, 282aa-380aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SLWVNGELAATTVEMATGHIVPEGGILQIGQEKNGCCVGGGFDETLAFSGRLTGFNIWDSVLSNEEIRETGGAESCHIRGNIVGWGVTEIQPHGGAQYV
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(PTX3 monoclonal antibody (M01), clone 5B7. Western Blot analysis of PTX3 expression in NIH/3T3 (Cat # L018V1).)

Western Blot (WB) (PTX3 monoclonal antibody (M01), clone 5B7. Western Blot analysis of PTX3 expression in NIH/3T3 (Cat # L018V1).)

Testing Data

(Detection limit for recombinant GST tagged PTX3 is approximately 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PTX3 is approximately 0.3ng/ml as a capture antibody.)

Western Blot (WB)

(PTX3 monoclonal antibody (M01), clone 5B7. Western Blot analysis of PTX3 expression in PC-12.)

Western Blot (WB) (PTX3 monoclonal antibody (M01), clone 5B7. Western Blot analysis of PTX3 expression in PC-12.)
Related Product Information for anti-PTX3 antibody
Mouse monoclonal antibody raised against a partial recombinant PTX3.
Product Categories/Family for anti-PTX3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
pentraxin-related protein PTX3
NCBI Official Synonym Full Names
pentraxin 3
NCBI Official Symbol
PTX3
NCBI Official Synonym Symbols
TSG-14; TNFAIP5
NCBI Protein Information
pentraxin-related protein PTX3
UniProt Protein Name
Pentraxin-related protein PTX3
Protein Family
UniProt Gene Name
PTX3
UniProt Synonym Gene Names
TNFAIP5; TSG14; TNF alpha-induced protein 5; TSG-14
UniProt Entry Name
PTX3_HUMAN

NCBI Description

This gene encodes a member of the pentraxin protein family. The expression of this protein is induced by inflammatory cytokines in response to inflammatory stimuli in several mesenchymal and epithelial cell types, particularly endothelial cells and mononuclear phagocytes. The protein promotes fibrocyte differentiation and is involved in regulating inflammation and complement activation. It also plays a role in angiogenesis and tissue remodeling. The protein serves as a biomarker for several inflammatory conditions. [provided by RefSeq, Jun 2016]

Uniprot Description

PTX3: Plays a role in the regulation of innate resistance to pathogens, inflammatory reactions, possibly clearance of self- components and female fertility.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 3q25

Cellular Component: extracellular space; extracellular region

Molecular Function: complement component C1q binding; zymosan binding; virion binding

Biological Process: positive regulation of nitric oxide biosynthetic process; negative regulation of virion penetration into host cell; positive regulation of phagocytosis; innate immune response; response to yeast; opsonization; inflammatory response

Research Articles on PTX3

Similar Products

Product Notes

The PTX3 ptx3 (Catalog #AAA6176815) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PTX3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PTX3 ptx3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PTX3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.