Mouse anti-Human PTTG1 Monoclonal Antibody | anti-PTTG1 antibody

PTTG1 (EAP1, PTTG, TUTR1, Securin, Esp1-associated Protein, Pituitary Tumor-transforming Gene 1 Protein) (HRP)

Cat. Num. AAA6154440

• Gene Names: PTTG1; EAP1; PTTG; HPTTG; TUTR1
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PTTG1; Monoclonal Antibody; PTTG1 (EAP1; PTTG; TUTR1; Securin; Esp1-associated Protein; Pituitary Tumor-transforming Gene 1 Protein) (HRP); anti-PTTG1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 2C3
• Specificity: Recognizes human PTTG1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 715

• Applicable Applications for anti-PTTG1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-101 from PTTG1 (NP_004210) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: LDIAPHAIERLHHMHIYPIVIFIHYKSAKHIKEQRDPIYLRDKVTQRHSKEQFEAAQKLEQEYSRYFTGVIQGGALSSICTQILAMVNQEQNKVLWIPACPL
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.96kD).)

Related Product Information for anti-PTTG1 antibody

PTTG1 is a homolog of yeast securin proteins, which prevent separins from promoting sister chromatid separation. It is an anaphase-promoting complex (APC) substrate that associates with a separin until activation of the APC. The protein has transforming activity in vitro and tumorigenic activity in vivo, and is highly expressed in various tumors. This protein contains 2 PXXP motifs, which are required for its transforming and tumorigenic activities, as well as for its stimulation of basic fibroblast growth factor expression. It also contains a destruction box (D box) that is required for its degradation by the APC. The acidic C-terminal region of the protein can act as a transactivation domain. It is mainly a cytosolic protein, although it partially localizes in the nucleus.

Product Categories/Family for anti-PTTG1 antibody

Antibodies; Cancer Markers

NCBI and Uniprot Product Information

• NCBI GI #: 1519243629
• NCBI GeneID: 9232
• NCBI Accession #: NM_004219.4
• NCBI GenBank Nucleotide #: NM_004219
• UniProt Accession #: O95997
• NCBI Official Full Name: Homo sapiens PTTG1 regulator of sister chromatid separation, securin (PTTG1), transcript variant 2, mRNA
• NCBI Official Synonym Full Names: PTTG1 regulator of sister chromatid separation, securin
• NCBI Official Symbol: PTTG1
• NCBI Official Synonym Symbols: EAP1; PTTG; HPTTG; TUTR1
• NCBI Protein Information: securin
• UniProt Protein Name: Securin
• UniProt Gene Name: PTTG1
• UniProt Synonym Gene Names: EAP1; PTTG; TUTR1; Tumor-transforming protein 1; hPTTG
• UniProt Entry Name: PTTG1_HUMAN

NCBI Description

The encoded protein is a homolog of yeast securin proteins, which prevent separins from promoting sister chromatid separation. It is an anaphase-promoting complex (APC) substrate that associates with a separin until activation of the APC. The gene product has transforming activity in vitro and tumorigenic activity in vivo, and the gene is highly expressed in various tumors. The gene product contains 2 PXXP motifs, which are required for its transforming and tumorigenic activities, as well as for its stimulation of basic fibroblast growth factor expression. It also contains a destruction box (D box) that is required for its degradation by the APC. The acidic C-terminal region of the encoded protein can act as a transactivation domain. The gene product is mainly a cytosolic protein, although it partially localizes in the nucleus. Three transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Sep 2013]

Uniprot Description

Securin: Regulatory protein, which plays a central role in chromosome stability, in the p53/TP53 pathway, and DNA repair. Probably acts by blocking the action of key proteins. During the mitosis, it blocks Separase/ESPL1 function, preventing the proteolysis of the cohesin complex and the subsequent segregation of the chromosomes. At the onset of anaphase, it is ubiquitinated, conducting to its destruction and to the liberation of ESPL1. Its function is however not limited to a blocking activity, since it is required to activate ESPL1. Negatively regulates the transcriptional activity and related apoptosis activity of TP53. The negative regulation of TP53 may explain the strong transforming capability of the protein when it is overexpressed. May also play a role in DNA repair via its interaction with Ku, possibly by connecting DNA damage-response pathways with sister chromatid separation. Belongs to the securin family.

Protein type: Oncoprotein; Cell cycle regulation

Chromosomal Location of Human Ortholog: 5q35.1

Cellular Component: cytoplasm; cytosol; nucleus

Molecular Function: protein binding; cysteine protease inhibitor activity; SH3 domain binding; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; mitosis; regulation of transcription, DNA-dependent; cell division; anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process; spermatogenesis; mitotic cell cycle; DNA repair; chromosome organization and biogenesis; chromosome segregation