Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to PTPRE on HeLa cell. [antibody concentration 10ug/ml])

Mouse anti-Human PTPRE Monoclonal Antibody | anti-PTPRE antibody

PTPRE (Receptor-type Tyrosine-protein Phosphatase epsilon, Protein-tyrosine Phosphatase epsilon, R-PTP-epsilon, DKFZp313F1310, FLJ57799, FLJ58245) (AP)

Gene Names
PTPRE; PTPE; HPTPE; R-PTP-EPSILON
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PTPRE; Monoclonal Antibody; PTPRE (Receptor-type Tyrosine-protein Phosphatase epsilon; Protein-tyrosine Phosphatase epsilon; R-PTP-epsilon; DKFZp313F1310; FLJ57799; FLJ58245) (AP); anti-PTPRE antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2D10
Specificity
Recognizes human PTPRE.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-PTPRE antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa511-601, from human PTPRE (AAH50062) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
WRMIWEWKSHTIVMLTEVQEREQDKCYQYWPTEGSVTHGEITIEIKNDTLSEAISIRDFLVTLNQPQARQEEQVRVVRQFHFHGWPEIGI
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PTPRE on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to PTPRE on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged PTPRE is ~10ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PTPRE is ~10ng/ml as a capture antibody.)
Product Categories/Family for anti-PTPRE antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
71,382 Da
NCBI Official Full Name
Homo sapiens protein tyrosine phosphatase, receptor type, E, mRNA
NCBI Official Synonym Full Names
protein tyrosine phosphatase, receptor type E
NCBI Official Symbol
PTPRE
NCBI Official Synonym Symbols
PTPE; HPTPE; R-PTP-EPSILON
NCBI Protein Information
receptor-type tyrosine-protein phosphatase epsilon

NCBI Description

The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. Several alternatively spliced transcript variants of this gene have been reported, at least two of which encode a receptor-type PTP that possesses a short extracellular domain, a single transmembrane region, and two tandem intracytoplasmic catalytic domains; another one encodes a PTP that contains a distinct hydrophilic N-terminus, and thus represents a nonreceptor-type isoform of this PTP. Studies of the similar gene in mice suggested the regulatory roles of this PTP in RAS related signal transduction pathways, cytokine-induced SATA signaling, as well as the activation of voltage-gated K+ channels. [provided by RefSeq, Oct 2015]

Research Articles on PTPRE

Similar Products

Product Notes

The PTPRE (Catalog #AAA6133224) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PTPRE (Receptor-type Tyrosine-protein Phosphatase epsilon, Protein-tyrosine Phosphatase epsilon, R-PTP-epsilon, DKFZp313F1310, FLJ57799, FLJ58245) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PTPRE can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PTPRE for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PTPRE, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.