Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged PTPN14 is 0.03 ng/ml as a capture antibody.)

Mouse PTPN14 Monoclonal Antibody | anti-PTPN14 antibody

PTPN14 (Protein Tyrosine Phosphatase, non-Receptor Type 14, MGC126803, PEZ, PTP36) (APC)

Gene Names
PTPN14; PEZ; PTP36
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
PTPN14; Monoclonal Antibody; PTPN14 (Protein Tyrosine Phosphatase; non-Receptor Type 14; MGC126803; PEZ; PTP36) (APC); Protein Tyrosine Phosphatase; PTP36; anti-PTPN14 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4F7
Specificity
Recognizes PTPN14.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-PTPN14 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
PTPN14 (NP_005392.2, 303aa-412aa) partial recombinant protein with GST tag.
Immunogen Sequence
KQNKICTEQSNSPPPIRRQPTWSRSSLPRQQPYILPPVHVQCGEHYSETHTSQDSIFHGNEEALYCNSHNSLDLNYLNGTVTNGSVCSVHSVNSLNCSQSFIQASPVSSN
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged PTPN14 is 0.03 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PTPN14 is 0.03 ng/ml as a capture antibody.)
Related Product Information for anti-PTPN14 antibody
The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP contains an N-terminal noncatalytic domain similar to that of band 4.1 superfamily cytoskeleton-associated proteins, which suggested the membrane or cytoskeleton localization of this protein. The specific function of this PTP has not yet been determined. [provided by RefSeq]
Product Categories/Family for anti-PTPN14 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
135,261 Da
NCBI Official Full Name
tyrosine-protein phosphatase non-receptor type 14
NCBI Official Synonym Full Names
protein tyrosine phosphatase, non-receptor type 14
NCBI Official Symbol
PTPN14
NCBI Official Synonym Symbols
PEZ; PTP36
NCBI Protein Information
tyrosine-protein phosphatase non-receptor type 14; protein-tyrosine phosphatase pez; cytoskeletal-associated protein tyrosine phosphatase
UniProt Protein Name
Tyrosine-protein phosphatase non-receptor type 14
UniProt Gene Name
PTPN14
UniProt Synonym Gene Names
PEZ; PTPD2
UniProt Entry Name
PTN14_HUMAN

Similar Products

Product Notes

The PTPN14 ptpn14 (Catalog #AAA6170345) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PTPN14 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PTPN14 ptpn14 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PTPN14, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.