Mouse PTK2B Monoclonal Antibody | anti-PTK2B antibody

PTK2B (PTK2B Protein Tyrosine Kinase 2 beta, CADTK, CAKB, FADK2, FAK2, FRNK, PKB, PTK, PYK2, RAFTK) (Biotin)

Cat. Num. AAA6174386

• Gene Names: PTK2B; PKB; PTK; CAKB; FAK2; PYK2; CADTK; FADK2; RAFTK
• Applications: Western Blot
• Purity: Purified
• Synonyms: PTK2B; Monoclonal Antibody; PTK2B (PTK2B Protein Tyrosine Kinase 2 beta; CADTK; CAKB; FADK2; FAK2; FRNK; PKB; PTK; PYK2; RAFTK) (Biotin); PTK2B Protein Tyrosine Kinase 2 beta; RAFTK; anti-PTK2B antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: X1
• Specificity: Recognizes PTK2B.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 1009

• Applicable Applications for anti-PTK2B antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: PTK2B (AAH36651, 682aa-871aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: VYQMEKDIAMEQERNARYRTPKILEPTAFQEPPPKPSRPKYRPPPQTNLLAPKLQFQVPEGLCASSPTLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMREEDFIQPSSREEAQQLWEAEKVKMRQILDKQQKQMVEDYQWLRQEEKSLDPMVYMNDKSPLTPEKEVGYLEFTGPPQKPPRLGAQSIQPTA
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(PTK2B monoclonal antibody (M03), clone X1 Western Blot analysis of PTK2B expression in K-562.)

Testing Data

(Detection limit for recombinant GST tagged PTK2B is approximately 0.1ng/ml as a capture antibody.)

Related Product Information for anti-PTK2B antibody

This gene encodes a cytoplasmic protein tyrosine kinase which is involved in calcium-induced regulation of ion channels and activation of the map kinase signaling pathway. The encoded protein may represent an important signaling intermediate between neuropeptide-activated receptors or neurotransmitters that increase calcium flux and the downstream signals that regulate neuronal activity. The encoded protein undergoes rapid tyrosine phosphorylation and activation in response to increases in the intracellular calcium concentration, nicotinic acetylcholine receptor activation, membrane depolarization, or protein kinase C activation. This protein has been shown to bind CRK-associated substrate, nephrocystin, GTPase regulator associated with FAK, and the SH2 domain of GRB2. The encoded protein is a member of the FAK subfamily of protein tyrosine kinases but lacks significant sequence similarity to kinases from other subfamilies. Four transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq]

Product Categories/Family for anti-PTK2B antibody

Antibodies; Tyrosine Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 34784998
• NCBI GeneID: 2185
• NCBI Official Full Name: PTK2B protein tyrosine kinase 2 beta
• NCBI Official Synonym Full Names: protein tyrosine kinase 2 beta
• NCBI Official Symbol: PTK2B
• NCBI Official Synonym Symbols: PKB; PTK; CAKB; FAK2; PYK2; CADTK; FADK2; RAFTK
• NCBI Protein Information: protein-tyrosine kinase 2-beta
• Protein Family: Protein-tyrosine kinase

NCBI Description

This gene encodes a cytoplasmic protein tyrosine kinase which is involved in calcium-induced regulation of ion channels and activation of the map kinase signaling pathway. The encoded protein may represent an important signaling intermediate between neuropeptide-activated receptors or neurotransmitters that increase calcium flux and the downstream signals that regulate neuronal activity. The encoded protein undergoes rapid tyrosine phosphorylation and activation in response to increases in the intracellular calcium concentration, nicotinic acetylcholine receptor activation, membrane depolarization, or protein kinase C activation. This protein has been shown to bind CRK-associated substrate, nephrocystin, GTPase regulator associated with FAK, and the SH2 domain of GRB2. The encoded protein is a member of the FAK subfamily of protein tyrosine kinases but lacks significant sequence similarity to kinases from other subfamilies. Four transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]