Mouse anti-Human PTK2B Monoclonal Antibody | anti-PTK2B antibody

PTK2B (Protein-tyrosine Kinase 2-beta, Calcium-dependent Tyrosine Kinase, CADTK, Cell Adhesion Kinase beta, CAK-beta, Focal Adhesion Kinase 2, FADK 2, Proline-rich Tyrosine Kinase 2, Related Adhesion Focal Tyrosine Kinase, RAFTK, FAK2, PYK2, RAFTK) (FITC)

Cat. Num. AAA6149121

• Gene Names: PTK2B; PKB; PTK; CAKB; FAK2; PYK2; CADTK; FADK2; RAFTK
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PTK2B; Monoclonal Antibody; PTK2B (Protein-tyrosine Kinase 2-beta; Calcium-dependent Tyrosine Kinase; CADTK; Cell Adhesion Kinase beta; CAK-beta; Focal Adhesion Kinase 2; FADK 2; Proline-rich Tyrosine Kinase 2; Related Adhesion Focal Tyrosine Kinase; RAFTK; FAK2; PYK2; RAFTK) (FITC); anti-PTK2B antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 1F9
• Specificity: Recognizes human PTK2B.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
• Sequence Length: 4730

• Applicable Applications for anti-PTK2B antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa682-871 from human PTK2B (AAH36651) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: VYQMEKDIAMEQERNARYRTPKILEPTAFQEPPPKPSRPKYRPPPQTNLLAPKLQFQVPEGLCASSPTLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMREEDFIQPSSREEAQQLWEAEKVKMRQILDKQQKQMVEDYQWLRQEEKSLDPMVYMNDKSPLTPEKEVGYLEFTGPPQKPPRLGAQSIQPTA
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (46.53kD).)

Western Blot (WB)

(PTK2B monoclonal antibody, Western Blot analysis of PTK2B expression in K-562.)

Western Blot (WB)

(Western Blot analysis of PTK2B expression in transfected 293T cell line by PTK2B monoclonal antibody. Lane 1: PTK2B transfected lysate (115.9kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of PTK2B transfected lysate using PTK2B monoclonal antibody and Protein A Magnetic Bead and immunoblotted with PTK2B rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged PTK2B is ~0.1ng/ml as a capture antibody.)

Related Product Information for anti-PTK2B antibody

PYK2 is involved in calcium induced regulation of ion channel and activation of the map kinase signaling pathway. PKY2 may represent an important signaling intermediate between neuropeptide activated receptors or neurotransmitters that increase calcium flux and the downstream signals that regulate neuronal activity. Interacts with the SH2 domain of Grb2. May phosphorylate the voltage-gated potassium channel protein Kv1.2. PYK2 activation is highly correlated with the stimulation of c-Jun N-terminal kinase activity. It's been shown to be involved in osmotic stress-dependent SNCA 'Tyr-125' phosphorylation.

Product Categories/Family for anti-PTK2B antibody

Antibodies; Tyrosine Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 34784997
• NCBI GeneID: 2185
• NCBI Official Full Name: Homo sapiens PTK2B protein tyrosine kinase 2 beta, mRNA
• NCBI Official Synonym Full Names: protein tyrosine kinase 2 beta
• NCBI Official Symbol: PTK2B
• NCBI Official Synonym Symbols: PKB; PTK; CAKB; FAK2; PYK2; CADTK; FADK2; RAFTK
• NCBI Protein Information: protein-tyrosine kinase 2-beta
• Protein Family: Protein-tyrosine kinase

NCBI Description

This gene encodes a cytoplasmic protein tyrosine kinase which is involved in calcium-induced regulation of ion channels and activation of the map kinase signaling pathway. The encoded protein may represent an important signaling intermediate between neuropeptide-activated receptors or neurotransmitters that increase calcium flux and the downstream signals that regulate neuronal activity. The encoded protein undergoes rapid tyrosine phosphorylation and activation in response to increases in the intracellular calcium concentration, nicotinic acetylcholine receptor activation, membrane depolarization, or protein kinase C activation. This protein has been shown to bind CRK-associated substrate, nephrocystin, GTPase regulator associated with FAK, and the SH2 domain of GRB2. The encoded protein is a member of the FAK subfamily of protein tyrosine kinases but lacks significant sequence similarity to kinases from other subfamilies. Four transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]