Mouse anti-Human PTGIR Monoclonal Antibody | anti-PTGIR antibody

PTGIR (PRIPR, Prostacyclin Receptor, Prostaglandin I2 Receptor, Prostanoid IP Receptor, MGC102830) (HRP)

Cat. Num. AAA6154419

• Gene Names: PTGIR; IP; PRIPR
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PTGIR; Monoclonal Antibody; PTGIR (PRIPR; Prostacyclin Receptor; Prostaglandin I2 Receptor; Prostanoid IP Receptor; MGC102830) (HRP); anti-PTGIR antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 4B10
• Specificity: Recognizes human PTGIR.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-PTGIR antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa296-387, from human PTGIR (NP_000951) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: RKAVFQRLKLWVCCLCLGPAHGDSQTPLSQLASGRRDPRAPSAPVGKEGSCVPLSAWGEGQVEPLPPTQQSSGSAVGTSSKAEASVACSLC
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(PTGIR monoclonal antibody, Western Blot analysis of PTGIR expression in A-549.)

Western Blot (WB)

(Western Blot analysis of PTGIR expression in transfected 293T cell line by PTGIR monoclonal antibody, Lane 1: PTGIR transfected lysate (41kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to PTGIR on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged PTGIR is ~0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-PTGIR antibody

Antibodies; Prostaglandins

NCBI and Uniprot Product Information

• NCBI GI #: 4506263
• NCBI GeneID: 5739
• NCBI Accession #: NP_000951
• NCBI GenBank Nucleotide #: NM_000960
• UniProt Accession #: P43119
• Molecular Weight: 42kDa
• NCBI Official Full Name: prostacyclin receptor
• NCBI Official Synonym Full Names: prostaglandin I2 receptor
• NCBI Official Symbol: PTGIR
• NCBI Official Synonym Symbols: IP; PRIPR
• NCBI Protein Information: prostacyclin receptor
• UniProt Protein Name: Prostacyclin receptor
• Protein Family: Prostacyclin receptor
• UniProt Gene Name: PTGIR
• UniProt Synonym Gene Names: PRIPR; PGI receptor
• UniProt Entry Name: PI2R_HUMAN

NCBI Description

The protein encoded by this gene is a member of the G-protein coupled receptor family 1 and has been shown to be a receptor for prostacyclin. Prostacyclin, the major product of cyclooxygenase in macrovascular endothelium, elicits a potent vasodilation and inhibition of platelet aggregation through binding to this receptor. [provided by RefSeq, Jul 2008]

Uniprot Description

PTGIR: Receptor for prostacyclin (prostaglandin I2 or PGI2). The activity of this receptor is mediated by G(s) proteins which activate adenylate cyclase. Belongs to the G-protein coupled receptor 1 family.

Protein type: Receptor, GPCR; Membrane protein, multi-pass; GPCR, family 1; Membrane protein, integral

Chromosomal Location of Human Ortholog: 19q13.3

Cellular Component: integral to plasma membrane; plasma membrane; cytosol

Molecular Function: G-protein coupled receptor activity; guanyl-nucleotide exchange factor activity

Biological Process: G-protein signaling, coupled to cyclic nucleotide second messenger; cell-cell signaling; negative regulation of smooth muscle cell proliferation; positive regulation of cAMP biosynthetic process; response to lipopolysaccharide; blood coagulation; G-protein signaling, adenylate cyclase activating pathway; positive regulation of GTPase activity