Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.52kD).)

Mouse anti-Human PSMD6 Monoclonal Antibody | anti-PSMD6 antibody

PSMD6 (26S Proteasome Non-ATPase Regulatory Subunit 6, 26S Proteasome Regulatory Subunit RPN7, 26S Proteasome Regulatory Subunit S10, Breast Cancer-associated Protein SGA-113M, Phosphonoformate Immuno-associated Protein 4, Proteasome Regulatory Particle S

Gene Names
PSMD6; S10; Rpn7; p42A; p44S10; SGA-113M
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PSMD6; Monoclonal Antibody; PSMD6 (26S Proteasome Non-ATPase Regulatory Subunit 6; 26S Proteasome Regulatory Subunit RPN7; 26S Proteasome Regulatory Subunit S10; Breast Cancer-associated Protein SGA-113M; Phosphonoformate Immuno-associated Protein 4; Proteasome Regulatory Particle S; anti-PSMD6 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1C1
Specificity
Recognizes human PSMD6.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
1362
Applicable Applications for anti-PSMD6 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa292-389 from PSMD6 (NP_055629) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
YRYYVREMRIHAYSQLLESYRSLTLGYMAEAFGVGVEFIDQELSRFIAAGRLHCKIDKVNEIVETNRPDSKNWQYQETIKKGDLLLNRVQKLSRVINM
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.52kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.52kD).)

Western Blot (WB)

(Western Blot analysis of PSMD6 expression in transfected 293T cell line by PSMD6 monoclonal antibody. Lane 1: PSMD6 transfected lysate (45.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PSMD6 expression in transfected 293T cell line by PSMD6 monoclonal antibody. Lane 1: PSMD6 transfected lysate (45.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB)

(Western blot analysis of PSMD6 over-expressed 293 cell line, cotransfected with PSMD6 Validated Chimera RNAi Lane 2) or non-transfected control (Lane 1). Blot probed with PSMD6 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of PSMD6 over-expressed 293 cell line, cotransfected with PSMD6 Validated Chimera RNAi Lane 2) or non-transfected control (Lane 1). Blot probed with PSMD6 monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)
Related Product Information for anti-PSMD6 antibody
Acts as a regulatory subunit of the 26S proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins.
Product Categories/Family for anti-PSMD6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
Homo sapiens proteasome 26S subunit, non-ATPase 6 (PSMD6), transcript variant 2, mRNA
NCBI Official Synonym Full Names
proteasome 26S subunit, non-ATPase 6
NCBI Official Symbol
PSMD6
NCBI Official Synonym Symbols
S10; Rpn7; p42A; p44S10; SGA-113M
NCBI Protein Information
26S proteasome non-ATPase regulatory subunit 6

NCBI Description

This gene encodes a member of the protease subunit S10 family. The encoded protein is a subunit of the 26S proteasome which colocalizes with DNA damage foci and is involved in the ATP-dependent degradation of ubiquinated proteins. Alternative splicing results in multiple transcript variants [provided by RefSeq, Nov 2012]

Research Articles on PSMD6

Similar Products

Product Notes

The PSMD6 (Catalog #AAA6154406) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PSMD6 (26S Proteasome Non-ATPase Regulatory Subunit 6, 26S Proteasome Regulatory Subunit RPN7, 26S Proteasome Regulatory Subunit S10, Breast Cancer-associated Protein SGA-113M, Phosphonoformate Immuno-associated Protein 4, Proteasome Regulatory Particle S reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PSMD6 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PSMD6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PSMD6, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.