Mouse anti-Human PSMC3 Monoclonal Antibody | anti-PSMC3 antibody

PSMC3 (26S Protease Regulatory Subunit 6A, Proteasome 26S Subunit ATPase 3, 26S Proteasome AAA-ATPase Subunit RPT5, Tat-binding Protein 1, TBP-1, Proteasome Subunit P50, TBP1) (HRP)

Cat. Num. AAA6154400

• Gene Names: PSMC3; TBP1
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PSMC3; Monoclonal Antibody; PSMC3 (26S Protease Regulatory Subunit 6A; Proteasome 26S Subunit ATPase 3; 26S Proteasome AAA-ATPase Subunit RPT5; Tat-binding Protein 1; TBP-1; Proteasome Subunit P50; TBP1) (HRP); anti-PSMC3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1B9
• Specificity: Recognizes human PSMC3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 1582

• Applicable Applications for anti-PSMC3 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa53-152, from human PSMC3 (AAH08713) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MNLLPNIESPVTRQEKMATVWDEAEQDGIGEEVLKMSTEEIIQRTRLLDSEIKIMKSEVLRVTHELQAMKDKIKENSEKIKVNKTLPYLVSNVIELLDVD
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(PSMC3 monoclonal antibody, Western Blot analysis of PSMC3 expression in HeLa.)

Testing Data

(Detection limit for recombinant GST tagged PSMC3 is 0.03ng/ml as a capture antibody.)

Related Product Information for anti-PSMC3 antibody

The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes one of the ATPase subunits, a member of the triple-A family of ATPases that have chaperone-like activity. This subunit may compete with PSMC2 for binding to the HIV tat protein to regulate the interaction between the viral protein and the transcription complex. A pseudogene has been identified on chromosome 9. [provided by RefSeq]

Product Categories/Family for anti-PSMC3 antibody

Antibodies; Proteasomes

NCBI and Uniprot Product Information

• NCBI GI #: 33870815
• NCBI GeneID: 5702
• NCBI Official Full Name: Homo sapiens proteasome (prosome, macropain) 26S subunit, ATPase, 3, mRNA
• NCBI Official Synonym Full Names: proteasome 26S subunit, ATPase 3
• NCBI Official Symbol: PSMC3
• NCBI Official Synonym Symbols: TBP1
• NCBI Protein Information: 26S proteasome regulatory subunit 6A
• Protein Family: 26S protease regulatory

NCBI Description

The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes one of the ATPase subunits, a member of the triple-A family of ATPases that have chaperone-like activity. This subunit may compete with PSMC2 for binding to the HIV tat protein to regulate the interaction between the viral protein and the transcription complex. A pseudogene has been identified on chromosome 9. [provided by RefSeq, Jul 2008]