Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human PSMB2 Monoclonal Antibody | anti-PSMB2 antibody

PSMB2 (Proteasome Subunit beta Type-2, Proteasome Component C7-I, Macropain Subunit C7-I, Multicatalytic Endopeptidase Complex Subunit C7-I, MGC104215, MGC126885) (MaxLight 650)

Gene Names
PSMB2; HC7-I
Reactivity
Human
Applications
Immunohistochemistry
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PSMB2; Monoclonal Antibody; PSMB2 (Proteasome Subunit beta Type-2; Proteasome Component C7-I; Macropain Subunit C7-I; Multicatalytic Endopeptidase Complex Subunit C7-I; MGC104215; MGC126885) (MaxLight 650); anti-PSMB2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
M1
Specificity
Recognizes human PSMB2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-PSMB2 antibody
FLISA, Immunohistochemistry (IHC) Paraffin
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to human PSMB2, aa1-202, with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQGS
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-PSMB2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
22,836 Da
NCBI Official Full Name
Homo sapiens proteasome (prosome, macropain) subunit, beta type, 2, mRNA
NCBI Official Synonym Full Names
proteasome subunit beta 2
NCBI Official Symbol
PSMB2
NCBI Official Synonym Symbols
HC7-I
NCBI Protein Information
proteasome subunit beta type-2
UniProt Protein Name
Proteasome subunit beta type-2
Protein Family
UniProt Gene Name
PSMB2
UniProt Entry Name
PSB2_HUMAN

NCBI Description

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Dec 2010]

Uniprot Description

PSMB2: The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This subunit has a trypsin-like activity. Belongs to the peptidase T1B family.

Protein type: Cell cycle regulation; Protease; EC 3.4.25.1; Proteasome complex

Chromosomal Location of Human Ortholog: 1p34.2

Cellular Component: nucleoplasm; proteasome complex; proteasome core complex; membrane; cytosol; nucleus

Molecular Function: threonine endopeptidase activity; protein binding

Biological Process: positive regulation of ubiquitin-protein ligase activity during mitotic cell cycle; negative regulation of ubiquitin-protein ligase activity during mitotic cell cycle; protein polyubiquitination; viral reproduction; apoptosis; antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent; response to organic nitrogen; DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest; response to organic cyclic substance; regulation of apoptosis; antigen processing and presentation of peptide antigen via MHC class I; regulation of ubiquitin-protein ligase activity during mitotic cell cycle; anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process; antigen processing and presentation of exogenous peptide antigen via MHC class I; gene expression; mitotic cell cycle; regulation of amino acid metabolic process; G1/S transition of mitotic cell cycle; negative regulation of apoptosis

Research Articles on PSMB2

Similar Products

Product Notes

The PSMB2 psmb2 (Catalog #AAA6224074) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PSMB2 (Proteasome Subunit beta Type-2, Proteasome Component C7-I, Macropain Subunit C7-I, Multicatalytic Endopeptidase Complex Subunit C7-I, MGC104215, MGC126885) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PSMB2 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunohistochemistry (IHC) Paraffin. IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PSMB2 psmb2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PSMB2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.