Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human, Rat Progesterone Receptor Monoclonal Antibody | anti-PgR antibody

Progesterone Receptor (PgR, PR, Nuclear Receptor Subfamily 3 Group C Member 3, NR3C3) (MaxLight 550)

Gene Names
PGR; PR; NR3C3
Reactivity
Human, Rat
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Progesterone Receptor; Monoclonal Antibody; Progesterone Receptor (PgR; PR; Nuclear Receptor Subfamily 3 Group C Member 3; NR3C3) (MaxLight 550); anti-PgR antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3E11
Specificity
Recognizes human PGR. Species Crossreactivity: rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-PgR antibody
FLISA, Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa1-110 from human PGR (NP_000917) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MTELKAKGPRAPHVAGGPPSPEVGSPLLCRPAAGPFPGSQTSDTLPEVSAIPISLDGLLFPRPCQGQDPSDEKTQDQQSLSDVEGAYSRAEATRGAGGSSSSPPEKDSGL
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-PgR antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
87,747 Da
NCBI Official Full Name
progesterone receptor isoform B
NCBI Official Synonym Full Names
progesterone receptor
NCBI Official Symbol
PGR
NCBI Official Synonym Symbols
PR; NR3C3
NCBI Protein Information
progesterone receptor; nuclear receptor subfamily 3 group C member 3
UniProt Protein Name
Progesterone receptor
Protein Family
UniProt Gene Name
PGR
UniProt Synonym Gene Names
NR3C3; PR
UniProt Entry Name
PRGR_HUMAN

Uniprot Description

PR: a nuclear hormone receptor and transcription factor. Regulates gene expression and affects cellular proliferation and differentiation in target tissues. Two splice-variant isoforms have been described.

Protein type: Nuclear receptor; DNA-binding

Chromosomal Location of Human Ortholog: 11q22-q23

Cellular Component: nucleoplasm; mitochondrial outer membrane

Molecular Function: protein binding; ligand-dependent nuclear receptor activity; enzyme binding; DNA binding; zinc ion binding; steroid hormone receptor activity; steroid binding; receptor binding

Biological Process: transcription initiation from RNA polymerase II promoter; progesterone receptor signaling pathway; cell-cell signaling; epithelial cell maturation; positive regulation of transcription from RNA polymerase II promoter; steroid hormone mediated signaling; gene expression; signal transduction; ovulation from ovarian follicle; regulation of epithelial cell proliferation

Disease: Progesterone Resistance

Similar Products

Product Notes

The PgR pgr (Catalog #AAA6213365) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Progesterone Receptor (PgR, PR, Nuclear Receptor Subfamily 3 Group C Member 3, NR3C3) (MaxLight 550) reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Progesterone Receptor can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PgR pgr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Progesterone Receptor, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.