Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human PRKRIR Monoclonal Antibody | anti-PRKRIR antibody

PRKRIR (52kD Repressor of the Inhibitor of the Protein Kinase, p52rIPK, 58kD Interferon-induced Protein Kinase-interacting Protein, p58IPK-interacting Protein, Death-associated Protein 4, THAP Domain-containing Protein 0, DAP4, P52RIPK, THAP0, MGC102750)

Gene Names
THAP12; DAP4; THAP0; PRKRIR; P52rIPK
Reactivity
Human
Applications
FLISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PRKRIR; Monoclonal Antibody; PRKRIR (52kD Repressor of the Inhibitor of the Protein Kinase; p52rIPK; 58kD Interferon-induced Protein Kinase-interacting Protein; p58IPK-interacting Protein; Death-associated Protein 4; THAP Domain-containing Protein 0; DAP4; P52RIPK; THAP0; MGC102750); anti-PRKRIR antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1C10-1A6
Specificity
Recognizes human PRKRIR.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Applicable Applications for anti-PRKRIR antibody
FLISA
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to human PRKRIR, aa1-151 (AAH21992) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MGQLKFNTSEEHHADMYRSDLPNPDTLSAELHCWRIKWKHRGKDIELPSTIYEALHLPDIKFFPNVYALLKVLCILPVMKVENERYENGRKRLKAYLRNTLTDQRSSNLALLNINFDIKHDLDLMVDTYIKLYTSKSELPTDNSETVENT
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-PRKRIR antibody
Upstream regulator of interferon-induced serine/threonine protein kinase R (PKR). May block the PKR-inhibitory function of P58IPK, resulting in restoration of kinase activity and suppression of cell growth.
Product Categories/Family for anti-PRKRIR antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
56,656 Da
NCBI Official Full Name
Homo sapiens protein-kinase, interferon-inducible double stranded RNA dependent inhibitor, repressor of (P58 repressor), mRNA
NCBI Official Synonym Full Names
THAP domain containing 12
NCBI Official Symbol
THAP12
NCBI Official Synonym Symbols
DAP4; THAP0; PRKRIR; P52rIPK
NCBI Protein Information
52 kDa repressor of the inhibitor of the protein kinase

Research Articles on PRKRIR

Similar Products

Product Notes

The PRKRIR (Catalog #AAA6202681) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PRKRIR (52kD Repressor of the Inhibitor of the Protein Kinase, p52rIPK, 58kD Interferon-induced Protein Kinase-interacting Protein, p58IPK-interacting Protein, Death-associated Protein 4, THAP Domain-containing Protein 0, DAP4, P52RIPK, THAP0, MGC102750) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PRKRIR can be used in a range of immunoassay formats including, but not limited to, FLISA. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PRKRIR for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PRKRIR, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.