Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Immunoperoxidase of monoclonal antibody to PRKG1 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml])

Mouse PRKG1 Monoclonal Antibody | anti-PRKG1 antibody

PRKG1 (Protein Kinase, cGMP-Dependent, Type I, CGKI, DKFZp686K042, FLJ36117, MGC71944, PGK, PKG, PRKG1B, PRKGR1B, cGKI-BETA, cGKI-alpha) (AP)

Gene Names
PRKG1; 1; PKG; cGK; AAT8; cGK1; cGKI; cGK 1; PRKG1B; PRKGR1B; cGKI-BETA; cGKI-alpha
Applications
Immunohistochemistry, Western Blot
Purity
Purified
Synonyms
PRKG1; Monoclonal Antibody; PRKG1 (Protein Kinase; cGMP-Dependent; Type I; CGKI; DKFZp686K042; FLJ36117; MGC71944; PGK; PKG; PRKG1B; PRKGR1B; cGKI-BETA; cGKI-alpha) (AP); Protein Kinase; cGKI-alpha; anti-PRKG1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2B3
Specificity
Recognizes PRKG1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-PRKG1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
PRKG1 (NP_006249, 73aa-170aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGV
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to PRKG1 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml])

Testing Data (Immunoperoxidase of monoclonal antibody to PRKG1 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to PRKG1 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to PRKG1 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml])

Testing Data

(Detection limit for recombinant GST tagged PRKG1 is approximately 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PRKG1 is approximately 0.1ng/ml as a capture antibody.)
Related Product Information for anti-PRKG1 antibody
Mouse monoclonal antibody raised against a partial recombinant PRKG1.
Product Categories/Family for anti-PRKG1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44,185 Da
NCBI Official Full Name
cGMP-dependent protein kinase 1 isoform 2
NCBI Official Synonym Full Names
protein kinase, cGMP-dependent, type I
NCBI Official Symbol
PRKG1
NCBI Official Synonym Symbols
1; PKG; cGK; AAT8; cGK1; cGKI; cGK 1; PRKG1B; PRKGR1B; cGKI-BETA; cGKI-alpha
NCBI Protein Information
cGMP-dependent protein kinase 1; protein kinase, cGMP-dependent, regulatory, type I, beta
UniProt Protein Name
cGMP-dependent protein kinase 1
UniProt Gene Name
PRKG1
UniProt Synonym Gene Names
PRKG1B; PRKGR1A; PRKGR1B; cGK 1; cGK1; cGKI
UniProt Entry Name
KGP1_HUMAN

Uniprot Description

PKG1: an AGC kinase of the PKG family. Type I cGMP-dependent protein kinase; relaxes vascular smooth muscle and inhibits platelet aggregation. Binding of cGMP results in enzyme activation. Two splice variant isoforms have been described.

Protein type: Kinase, protein; Protein kinase, Ser/Thr (non-receptor); EC 2.7.11.12; Protein kinase, AGC; AGC group; PKG family

Chromosomal Location of Human Ortholog: 10q11.2

Cellular Component: Golgi apparatus; cytoplasm; plasma membrane; cytosol

Molecular Function: protein binding; calcium channel regulator activity; cGMP-dependent protein kinase activity; cGMP binding; ATP binding

Biological Process: regulation of GTPase activity; relaxation of vascular smooth muscle; cGMP-mediated signaling; forebrain development; dendrite development; neuron migration; signal transduction; blood coagulation; actin cytoskeleton organization and biogenesis; protein amino acid phosphorylation

Similar Products

Product Notes

The PRKG1 prkg1 (Catalog #AAA6162191) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PRKG1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PRKG1 prkg1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PRKG1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.